DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17819 and arc-1

DIOPT Version :10

Sequence 1:NP_650994.1 Gene:CG17819 / 42579 FlyBaseID:FBgn0038915 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_496089.3 Gene:arc-1 / 174525 WormBaseID:WBGene00000180 Length:539 Species:Caenorhabditis elegans


Alignment Length:186 Identity:48/186 - (25%)
Similarity:75/186 - (40%) Gaps:56/186 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KSCLLILGLDNAGKSTLTDRLAEI-------------FNGESKESNNQVSEWSFTIN--NFRVQL 69
            :|.:::||||.|||:::..||.::             ||.|             ||:  |:|:..
 Worm   369 ESRVVLLGLDGAGKTSIVRRLKKVQMDTVMAPHPTIGFNIE-------------TIHYKNYRLNF 420

  Fly    70 WDINGELKNRQIWPKYYKKVNVLIFVLDSTDALRLSEARCVLCDVLMHQELDNAPLLIVSNKKDA 134
            ||:.|..|.|.:|..||.....:.:|:|.....|.|||...|..|:....:...|:::..|:||.
 Worm   421 WDVGGLPKLRHLWKHYYSNAQAIFYVIDGYAVERFSEAIKELNRVMSDPLVGTCPVIVAVNRKDG 485

  Fly   135 SGSLSMSTVIDLMGLYRLTGR-------------DWTFEECSMRTGSGVQEIVNWI 177
                           |.|.|.             ...|..|...||||:.:|::.|
 Worm   486 ---------------YALNGHMDALLSQLEALPFQHHFHCCDAATGSGIDQIIDQI 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17819NP_650994.1 Arf_Arl 22..180 CDD:206644 47/184 (26%)
arc-1NP_496089.3 mRING-HC-C3HC3D_arc-1-like 3..56 CDD:438486
Bbox2_TRIM23_C-IX_rpt1 104..153 CDD:380831
Bbox2_TRIM23_C-IX_rpt2 156..205 CDD:380832
BBC 208..339 CDD:128778
Arf_Arl 371..526 CDD:206644 46/182 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.