DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17819 and Arl1

DIOPT Version :10

Sequence 1:NP_650994.1 Gene:CG17819 / 42579 FlyBaseID:FBgn0038915 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_320779.4 Gene:Arl1 / 1280909 VectorBaseID:AGAMI1_004415 Length:180 Species:Anopheles gambiae


Alignment Length:187 Identity:59/187 - (31%)
Similarity:98/187 - (52%) Gaps:23/187 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GPVSFIKKILPAGSQKSCLLILGLDNAGKSTLTDRL--AEI--------FNGESKESNNQVSEWS 59
            |..|:.:.:|  ||::..:||||||.|||:|:..||  .|:        ||.|      ||    
Mosquito     3 GLFSYFRGLL--GSREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVE------QV---- 55

  Fly    60 FTINNFRVQLWDINGELKNRQIWPKYYKKVNVLIFVLDSTDALRLSEARCVLCDVLMHQELDNAP 124
             |..|.:.|:||:.|:...|..|..||...:.:|:|:||.|..|:..::..|..:|...||..|.
Mosquito    56 -TYKNLKFQVWDLGGQTSIRPYWRCYYSNTDAIIYVVDSADKDRIGISKDELLYMLREDELAGAI 119

  Fly   125 LLIVSNKKDASGSLSMSTVIDLMGLYRLTGRDWTFEECSMRTGSGVQEIVNWINEKI 181
            |::::||:|..|.:|::.|...:||..|..|.:...:.|...|.|:.:.::|::..:
Mosquito   120 LVVLANKQDMEGCMSVAEVHQALGLEALKNRTFQIFKTSATKGEGLDQAMDWLSNAL 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17819NP_650994.1 Arf_Arl 22..180 CDD:206644 54/167 (32%)
Arl1XP_320779.4 None

Return to query results.
Submit another query.