DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17819 and Arf102F

DIOPT Version :10

Sequence 1:NP_650994.1 Gene:CG17819 / 42579 FlyBaseID:FBgn0038915 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_311973.1 Gene:Arf102F / 1273032 VectorBaseID:AGAMI1_000714 Length:180 Species:Anopheles gambiae


Alignment Length:175 Identity:55/175 - (31%)
Similarity:92/175 - (52%) Gaps:21/175 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GSQKSCLLILGLDNAGKSTLTD--RLAEI--------FNGESKESNNQVSEWSFTINNFRVQLWD 71
            |.::..:|::|||.|||:|:..  :|.||        ||.|:.|..|    ..||:       ||
Mosquito    14 GKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN----ICFTV-------WD 67

  Fly    72 INGELKNRQIWPKYYKKVNVLIFVLDSTDALRLSEARCVLCDVLMHQELDNAPLLIVSNKKDASG 136
            :.|:.|.|.:|..|::....||||:||.|..|:.||...|..:|...||.:|.||:.:||:|...
Mosquito    68 VGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIVEAEKELHSMLQEDELRDAVLLVFANKQDLPN 132

  Fly   137 SLSMSTVIDLMGLYRLTGRDWTFEECSMRTGSGVQEIVNWINEKI 181
            :::.:.:.|.:.|.:|..|.|..:......|.|:.|.::|::.::
Mosquito   133 AMTAAELTDKLHLNQLRNRHWYIQATCATQGHGLYEGLDWLSTEL 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17819NP_650994.1 Arf_Arl 22..180 CDD:206644 54/167 (32%)
Arf102FXP_311973.1 P-loop containing Nucleoside Triphosphate Hydrolases 1..180 CDD:476819 55/175 (31%)

Return to query results.
Submit another query.