DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17819 and Arf4

DIOPT Version :10

Sequence 1:NP_650994.1 Gene:CG17819 / 42579 FlyBaseID:FBgn0038915 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_031505.1 Gene:Arf4 / 11843 MGIID:99433 Length:180 Species:Mus musculus


Alignment Length:176 Identity:57/176 - (32%)
Similarity:96/176 - (54%) Gaps:21/176 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GSQKSCLLILGLDNAGKSTLTD--RLAEI--------FNGESKESNNQVSEWSFTINNFRVQLWD 71
            |.::..:|::|||.|||:|:..  :|.||        ||.|:.|..|    ..||:       ||
Mouse    14 GKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN----ICFTV-------WD 67

  Fly    72 INGELKNRQIWPKYYKKVNVLIFVLDSTDALRLSEARCVLCDVLMHQELDNAPLLIVSNKKDASG 136
            :.|:.|.|.:|..|::....||||:||.|..|:.|...||..:|:..||.:|.||:.:||:|...
Mouse    68 VGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIQEGAAVLQKMLLEDELQDAVLLLFANKQDLPN 132

  Fly   137 SLSMSTVIDLMGLYRLTGRDWTFEECSMRTGSGVQEIVNWINEKIN 182
            ::::|.:.|.:||..|..|.|..:......|:|:.|.::|::.:::
Mouse   133 AMAISEMTDKLGLQSLRNRTWYVQATCATQGTGLYEGLDWLSNELS 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17819NP_650994.1 Arf_Arl 22..180 CDD:206644 56/167 (34%)
Arf4NP_031505.1 P-loop containing Nucleoside Triphosphate Hydrolases 1..180 CDD:476819 57/176 (32%)

Return to query results.
Submit another query.