DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17819 and Arf3

DIOPT Version :10

Sequence 1:NP_650994.1 Gene:CG17819 / 42579 FlyBaseID:FBgn0038915 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_031504.1 Gene:Arf3 / 11842 MGIID:99432 Length:181 Species:Mus musculus


Alignment Length:188 Identity:60/188 - (31%)
Similarity:104/188 - (55%) Gaps:23/188 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SFIKKILPAGSQKSCLLILGLDNAGKSTLTD--RLAEI--------FNGESKESNNQVSEWSFTI 62
            :.:|.::  |.::..:|::|||.|||:|:..  :|.||        ||.|:.|..|    .|||:
Mouse     7 NLLKSLI--GKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN----ISFTV 65

  Fly    63 NNFRVQLWDINGELKNRQIWPKYYKKVNVLIFVLDSTDALRLSEARCVLCDVLMHQELDNAPLLI 127
                   ||:.|:.|.|.:|..|::....||||:||.|..|::|||..|..:|...||.:|.||:
Mouse    66 -------WDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLV 123

  Fly   128 VSNKKDASGSLSMSTVIDLMGLYRLTGRDWTFEECSMRTGSGVQEIVNWINEKINNNR 185
            .:||:|...:::.:.:.|.:||:.|..|:|..:.....:|.|:.|.::|:..::.|.:
Mouse   124 FANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNKK 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17819NP_650994.1 Arf_Arl 22..180 CDD:206644 57/167 (34%)
Arf3NP_031504.1 P-loop containing Nucleoside Triphosphate Hydrolases 5..179 CDD:476819 59/184 (32%)

Return to query results.
Submit another query.