DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17819 and arf1

DIOPT Version :10

Sequence 1:NP_650994.1 Gene:CG17819 / 42579 FlyBaseID:FBgn0038915 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_958860.1 Gene:arf1 / 114428 ZFINID:ZDB-GENE-010724-5 Length:180 Species:Danio rerio


Alignment Length:179 Identity:59/179 - (32%)
Similarity:99/179 - (55%) Gaps:21/179 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GSQKSCLLILGLDNAGKSTLTD--RLAEI--------FNGESKESNNQVSEWSFTINNFRVQLWD 71
            |.::..:|::|||.|||:|:..  :|.||        ||.|:.|..|    .|||:       ||
Zfish    13 GKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN----ISFTV-------WD 66

  Fly    72 INGELKNRQIWPKYYKKVNVLIFVLDSTDALRLSEARCVLCDVLMHQELDNAPLLIVSNKKDASG 136
            :.|:.|.|.:|..|::....||||:||.|..|::|||..|..:|...||..|.||:.:||:|...
Zfish    67 VGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELREAVLLVFANKQDLPN 131

  Fly   137 SLSMSTVIDLMGLYRLTGRDWTFEECSMRTGSGVQEIVNWINEKINNNR 185
            :::.:.:.|.:||:.|..|:|..:.....:|.|:.|.::|::.::.|.:
Zfish   132 AMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLKNQK 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17819NP_650994.1 Arf_Arl 22..180 CDD:206644 57/167 (34%)
arf1NP_958860.1 P-loop containing Nucleoside Triphosphate Hydrolases 1..178 CDD:476819 58/175 (33%)

Return to query results.
Submit another query.