DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6656 and Acp6

DIOPT Version :9

Sequence 1:NP_650991.1 Gene:CG6656 / 42576 FlyBaseID:FBgn0038912 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_062774.2 Gene:Acp6 / 66659 MGIID:1931010 Length:418 Species:Mus musculus


Alignment Length:414 Identity:99/414 - (23%)
Similarity:177/414 - (42%) Gaps:105/414 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 EQGLRNLRMISILFRHGAKNPSGFYPLD------------------------------PHAAHDW 70
            ::.|..|:|:.::|||||::|....||:                              ||:.:|.
Mouse    37 DRNLLELKMVQVVFRHGARSPLKPLPLEEQVEWNPKLLEIPPQTRFDYTVTNLAGGPKPHSHYDT 101

  Fly    71 Q-------GGM--GALTPKGSLQAYNLGRNLRMRYYRLLP-PNSLYTQQQVNVLSSAAERCVMSA 125
            :       ||:  |.||..|..|.:.||..||..|...:| .:.:|..|:|.:.|:...|.:.|.
Mouse   102 EYRKTTLRGGVLAGQLTKVGMQQMFALGEKLRKNYVEDIPFLSPVYNPQEVFIRSTNMFRNLEST 166

  Fly   126 QSVLAGMMPPLENKNVLPIPWQPVAVNTLSRNEDILLAQKKPC--LKYDHILQKLYKSPPP---- 184
            :.:|||:....:...|         ::|...:.::|....:.|  ||.....:|......|    
Mouse   167 RCLLAGLFQHQKGSAV---------IHTDEASSEVLYPNYQSCWVLKEKTRGRKKAAISQPGISE 222

  Fly   185 ELQKL-------NEDNMELYKLLTKNTGKNISNVLDVELLYGTLKTEEEANLVLPDWTENIYPEE 242
            :|:|:       |.|:::.:.||.....:.:.::|:...|      |..|.|:           |
Mouse   223 DLEKVKTGVGINNGDDVDFFVLLDNVAAEQVHSLLNCPAL------ERFAQLI-----------E 270

  Fly   243 IRPLAERSYMLFTETNLMKRIKGGAFLTDILNKMQNKRKRNLNP------DRKIFLYSGHDVTLV 301
            .|.:....|::..|.....::..|.|    |:.::....:.::|      .||::||:.|||||:
Mouse   271 QRAVDMALYVVEQEDRESIQMAVGPF----LHILEGNLLKTVDPTTAPSKTRKMYLYATHDVTLL 331

  Fly   302 NVMNSLGILDQTTKLPEYASALAFELH-HSKSFSDGDFEVKLVYYYNSEDKFPKELTIPNC-DAP 364
            .::.:|||.||  |.|.:|..|..||: |.:|   .::.|:|  :||.:::.|:     .| |..
Mouse   332 PMLLALGIFDQ--KWPPFAVDLTMELYQHQES---KEWFVQL--FYNGKEQVPR-----GCPDKL 384

  Fly   365 CSLTQF--EASVKALLLDNYDETC 386
            |.|.:|  ..||.::..:.|...|
Mouse   385 CPLDKFLNTMSVYSVSPEKYRTLC 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6656NP_650991.1 HP_HAP_like 41..344 CDD:132717 86/362 (24%)
Acp6NP_062774.2 HP_HAP_like 42..371 CDD:132717 86/365 (24%)
Substrate binding. /evidence=ECO:0000250 51..161 27/109 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3720
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7717
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221585at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R958
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.