DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6656 and ACP2

DIOPT Version :9

Sequence 1:NP_650991.1 Gene:CG6656 / 42576 FlyBaseID:FBgn0038912 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001343945.1 Gene:ACP2 / 53 HGNCID:123 Length:434 Species:Homo sapiens


Alignment Length:360 Identity:114/360 - (31%)
Similarity:184/360 - (51%) Gaps:19/360 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 RNLRMISILFRHGAKNPSGFYPLDPHAAHDWQGGMGALTPKGSLQAYNLGRNLRMRYYRLLPPNS 104
            |:||.:::|:|||.::|...||.||:...:|..|.|.||.:|.||.:.||:.||.||:..|  |:
Human    31 RSLRFVTLLYRHGDRSPVKTYPKDPYQEEEWPQGFGQLTKEGMLQHWELGQALRQRYHGFL--NT 93

  Fly   105 LYTQQQVNVLSSAAERCVMSAQSVLAGMMPPLENKNVLP-IPWQPVAVNTLSRNEDILLA-QKKP 167
            .|.:|:|.|.|:..:|.:|||::.|||:.||...:...| |.|||:.|:|:...||.||. ...|
Human    94 SYHRQEVYVRSTDFDRTLMSAEANLAGLFPPNGMQRFNPNISWQPIPVHTVPITEDRLLKFPLGP 158

  Fly   168 CLKYDHILQKLYKSPPPELQKLNEDNMELYKLLTKNTGKNISNVLDVELLYGTLKTEEEANLVLP 232
            |.:|:.:..:..::  ||.|..:..|.:...::...||.....:..|..:|.||..|:...|.||
Human   159 CPRYEQLQNETRQT--PEYQNESSRNAQFLDMVANETGLTDLTLETVWNVYDTLFCEQTHGLRLP 221

  Fly   233 DWTENIYPEEIRPLAERSY-MLF--TETNLMKRIKGGAFLTDILNKMQNKRKRNLNPDRKIFLYS 294
            .|......:.:..|.:.|: .||  .:.....|::||..|..|...:......:..|  |:.:||
Human   222 PWASPQTMQRLSRLKDFSFRFLFGIYQQAEKARLQGGVLLAQIRKNLTLMATTSQLP--KLLVYS 284

  Fly   295 GHDVTLVNVMNSLGILDQTTKLPEYASALAFELHHSKSFSDGDFEVKLVYYYNSEDKFPKELTIP 359
            .||.|||.:..:|.:.:  .:...|||...|||:...|   |:|.|:: |:.|..||.|..|::|
Human   285 AHDTTLVALQMALDVYN--GEQAPYASCHIFELYQEDS---GNFSVEM-YFRNESDKAPWPLSLP 343

  Fly   360 NCDAPCSLTQFEASVKALLLDNYDETCE--NHPTD 392
            .|...|.|..|....:.::..::.:.|:  :.|.|
Human   344 GCPHRCPLQDFLRLTEPVVPKDWQQECQLASGPAD 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6656NP_650991.1 HP_HAP_like 41..344 CDD:132717 99/307 (32%)
ACP2NP_001343945.1 HP_HAP_like 33..330 CDD:132717 100/308 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221585at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11567
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R958
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
66.050

Return to query results.
Submit another query.