DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6656 and Acph-1

DIOPT Version :9

Sequence 1:NP_650991.1 Gene:CG6656 / 42576 FlyBaseID:FBgn0038912 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_733332.1 Gene:Acph-1 / 48445 FlyBaseID:FBgn0000032 Length:455 Species:Drosophila melanogaster


Alignment Length:416 Identity:122/416 - (29%)
Similarity:207/416 - (49%) Gaps:43/416 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDCKSRRGTKISVIALGS----------ALCFVMMAYFVFGDSNDEQGLRN-------------- 41
            |..:||.|:.::.:|...          .:|.:.:..|..  :|...|..|              
  Fly     1 MFSRSRCGSLVTSVARKMWNHPSQRWLILICVICLLSFAL--ANSLHGYANAEGHPVEISATLPG 63

  Fly    42 -LRMISILFRHGAKNPSGFYPLDPHAAHD-WQGGMGALTPKGSLQAYNLGRNLRMRYYRLLPPNS 104
             |:.:.:::|||.:.|...||.||..... |..|.|.||..|..:.|:||:.||.||..||||  
  Fly    64 QLKFVHVIYRHGDRTPVDPYPTDPWGDRKFWPTGWGDLTNLGKQEHYDLGKWLRNRYSNLLPP-- 126

  Fly   105 LYTQQQVNVLSSAAERCVMSAQSVLAGMMPPLENKNV--LPIPWQPVAVNTLSRNEDILLAQKKP 167
            :|:.:.:.|.|:..:|.:|||||.|||:..| :.:::  ..|.|||:.::|....||.:||.|.|
  Fly   127 IYSNENIYVQSTDVDRTLMSAQSNLAGLYEP-QGEDIWNTDINWQPIPIHTSPEREDPILAAKAP 190

  Fly   168 CLKYDHILQKLYKSPPPELQKLNEDNMELYKLLTKNTGKNISNVLDVELLYGTLKTEEEANLVLP 232
            |..||:.|..|..|  ||.:.|.|.:..|:..|::..|:.:...:|.:.|..||..|...|:.||
  Fly   191 CPAYDYELASLESS--PEFKALTEKHRNLFAYLSEKGGRPVKTFIDAQYLNNTLFIENLYNMTLP 253

  Fly   233 DWTENIY-PEEIRPLAERSYMLFTETNLMKRIKGGAFLTDILNKMQNKRKRNLNPDRKIFLYSGH 296
            .||:.:| .||:..::..::.:.:.|..:.|:|.|..|.||..:.:.|...:|.|||.:::||.|
  Fly   254 KWTKMVYGREELTYVSNFAFAISSYTRKLARLKAGPLLKDIFQRFKEKSSGSLKPDRSMWVYSAH 318

  Fly   297 DVTLVNVMNSLGILDQTTKLPEYASALAFELHHSKSFSDGDFEVKLVYYYNSEDKFPKELTIPNC 361
            |.|:.:|:|:|.:.:..:  |.|.:.:..||.    ..:.:..:..::|.|:..: |..|.||.|
  Fly   319 DTTVASVLNALKLFELHS--PPYTACIMMELR----VDETNTPLVSIFYKNTTAE-PLPLDIPGC 376

  Fly   362 DAPCSLTQFEASVKALLLDNYDETCE 387
            ...|.||:.....:.:|..:::..|:
  Fly   377 GPSCPLTKLMNIYEDVLPVDWERECK 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6656NP_650991.1 HP_HAP_like 41..344 CDD:132717 101/321 (31%)
Acph-1NP_733332.1 HP_HAP_like 64..361 CDD:132717 100/307 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 156 1.000 Domainoid score I4084
eggNOG 1 0.900 - - E1_KOG3720
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 64 1.000 Inparanoid score I1972
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221585at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11567
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R958
SonicParanoid 00.000 Not matched by this tool.
77.000

Return to query results.
Submit another query.