DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6656 and CG15385

DIOPT Version :9

Sequence 1:NP_650991.1 Gene:CG6656 / 42576 FlyBaseID:FBgn0038912 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001259914.1 Gene:CG15385 / 33396 FlyBaseID:FBgn0031397 Length:587 Species:Drosophila melanogaster


Alignment Length:420 Identity:91/420 - (21%)
Similarity:152/420 - (36%) Gaps:137/420 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 FVFGDSNDEQGLRNLRMISILFRHGAKNPSGFYPLDPHAAHDWQGGMGALTPKGSLQAYNLGRNL 92
            |::..|:...|..::....:...||       :||.|  |.:....:|.||.||..|..::|..:
  Fly   143 FLYNSSSSASGSNHMYWNKVGPFHG-------FPLLP--ATERGCPLGQLTYKGISQLLHVGDIM 198

  Fly    93 RMRYYR----LLPPN-----------SLYTQQQVNVLSSAAERCVMSAQSVLAGMMPP------- 135
            ...|..    ||.||           :|....:|.|.::...|...||.::|..::|.       
  Fly   199 HQVYAHPLGLLLKPNPNRASVETTPHTLLNSDEVVVFTTRYRRTFQSALAMLFTLLPADKWLALN 263

  Fly   136 ----------------------------------LENKNVLPI-PW--------QPVAVNTLSRN 157
                                              |:..:||.: .|        .|..::.....
  Fly   264 VRESHSMAFCFGECSCPQSALLRKRLEAMGDKQLLKRGDVLDVMQWIGGTILQHTPNGISNPFEV 328

  Fly   158 EDILLA-----QKKPCLKYDHILQKLYKSPPPELQKLNEDNMELYKLLTKNTGKNISNVLDVELL 217
            .|.||.     ...||.:     :|...:|.|               |.||:.:.:.:|::::  
  Fly   329 VDALLTVLCHDATLPCRR-----KKALSTPKP---------------LRKNSNQELVDVINID-- 371

  Fly   218 YGTLKTEEEANL-------VLPDWTE------NIYPEE-----IRPLAERSYMLFTETNLMKRIK 264
                :.|..|||       |.||..|      ::..:|     :.|....:.|.|.: .|.:|..
  Fly   372 ----QDETAANLMQEAQTQVEPDSPEVENGNPSVQADEAQEGCVEPSHVDTLMSFAD-ELSQRSA 431

  Fly   265 GGAF--LTDILNKMQNKRK------RNLNPDR-KIFLYSGHDVTLVNVMNSLGILDQTTKLPEYA 320
            |.::  |:.:|......|.      :.::.|| |..||||||.|:..:..:|||:....:...||
  Fly   432 GHSYYKLSGLLRSYGMIRHIVSYMLKMISGDRTKFVLYSGHDCTMQYLTAALGIITNQGQTIAYA 496

  Fly   321 SALAFELHHSKSFSDGDFEVKLVYYYNSED 350
            |.||||::.|.:.:|..|.|    .||.:|
  Fly   497 SRLAFEVYRSDAHTDYYFRV----VYNGKD 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6656NP_650991.1 HP_HAP_like 41..344 CDD:132717 85/399 (21%)
CG15385NP_001259914.1 HP 101..519 CDD:299704 88/415 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11567
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.