DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6656 and Acp4

DIOPT Version :9

Sequence 1:NP_650991.1 Gene:CG6656 / 42576 FlyBaseID:FBgn0038912 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_006229113.1 Gene:Acp4 / 308569 RGDID:1308270 Length:510 Species:Rattus norvegicus


Alignment Length:350 Identity:106/350 - (30%)
Similarity:163/350 - (46%) Gaps:47/350 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 ILFRHGAKNPSGFYPLDPH---AAHDWQGGMGALTPKGSLQAYNLGRNLRMRYYRLLPPNSLYTQ 108
            ::||||.:.|...||.|||   |:..|..|:|.||.:|..|...|||.||.||...|.|.  |.:
  Rat    22 MVFRHGDRAPLASYPTDPHKEAASTLWPRGLGQLTKEGIRQQLELGRFLRRRYKAFLSPE--YRR 84

  Fly   109 QQVNVLSSAAERCVMSAQSVLAGMMPPLENKNVLP----IPWQPVAVNTLSRNEDILLA-QKKPC 168
            ::|.:.|:..:|.:.|||:.|||:.|     ...|    ..|:|:.|:|:..:||.||. ..:.|
  Rat    85 EEVYIRSTDFDRTLESAQANLAGLFP-----EAAPGSPEADWKPIPVHTVPVSEDKLLRFPMRSC 144

  Fly   169 LKYDHILQKLYKSPPPELQKLNEDNMELYKLLTKNTGKNIS--------NVLDVELLYGTLKTEE 225
            .:|..:|::  .:...:.|:..|...:....|...||.::.        .|||      ||..:.
  Rat   145 PRYHELLRE--STEAADYQEALEGWTDFLTRLGNFTGLSLVGEPLRRAWKVLD------TLICQR 201

  Fly   226 EANLVLPDWTENIYPEEIRPLAE------RSYMLFTETNLMKRIKGGAFLTDILNKMQNKRKRNL 284
            ...|.||.|..   |:.:|.|::      |:::.........::.||..|..||:..  .|.:.|
  Rat   202 AHGLALPSWAS---PDVLRTLSQISALDIRAHVGPPRAAEKAQLTGGILLDAILSNF--SRAQRL 261

  Fly   285 NPDRKIFLYSGHDVTLVNVMNSLGILDQTTKLPEYASALAFELHHSK---SFSDGDFEVKLVYYY 346
            ....|:.:||.||.||:.:..:||:.|..|  |.||:.:|||...|.   ...||:.....:.|.
  Rat   262 GLPLKMVMYSAHDSTLLALQGALGLYDGNT--PPYAACMAFEFRGSSREPEEEDGENVTVSLIYR 324

  Fly   347 NSEDKFPKELTIPNCDAPCSLTQFE 371
            |...:.|..|.:|.|.|||.|.:|:
  Rat   325 NDTSRPPLPLRVPGCPAPCPLGRFQ 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6656NP_650991.1 HP_HAP_like 41..344 CDD:132717 95/321 (30%)
Acp4XP_006229113.1 HP_HAP_like 22..301 CDD:132717 90/300 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 156 1.000 Domainoid score I4084
eggNOG 1 0.900 - - E1_KOG3720
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221585at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11567
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.