DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6656 and acp-2

DIOPT Version :9

Sequence 1:NP_650991.1 Gene:CG6656 / 42576 FlyBaseID:FBgn0038912 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_495774.1 Gene:acp-2 / 174343 WormBaseID:WBGene00008802 Length:408 Species:Caenorhabditis elegans


Alignment Length:404 Identity:101/404 - (25%)
Similarity:164/404 - (40%) Gaps:126/404 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 ILFRHGAKNPSGFYPLDPHAAHDWQGGMGALTPKGSLQAYNLGRNLRMRYYRL------LPPNSL 105
            :||||||:.||.... ||....::..|:|.||.:|...::.|||.|:.||...      |.|..:
 Worm    30 VLFRHGARAPSNSLS-DPAYLANFPRGLGELTDRGFENSFRLGRFLKTRYVDSKFVDGNLKPRQM 93

  Fly   106 YTQQQVNVLSSAAERCVMSAQSVLAGMMPPLENKNVLPIPWQPVAVNTLSRN------EDILLAQ 164
            | .:.||     ..||:.||.:|.|.|.........:|:..:.:..|.|:.:      |..|:.:
 Worm    94 Y-WRSVN-----KNRCLSSASTVGAAMFEDPSRHLYVPVLTEEIGENLLNYDQANCPRELELIKE 152

  Fly   165 KKP------------------CLKYDHILQKLY----------------KSPPPELQKLNEDNME 195
            |.|                  ||||.|.:.|.|                ..||...|.:|| .|.
 Worm   153 KCPDFGGSFHPWTIYEEFIANCLKYTHPVFKQYPFHTIEAHINEYKNGIPLPPLIAQHINE-IMG 216

  Fly   196 LYKLLTK---NTGKNISNVLDVELLYGTLKTEEEANLVLPDWTENIYPEEIRPLAERSYMLFTET 257
            :|..:|:   .|| |..:...:::.:|                                      
 Worm   217 IYVNVTQFITGTG-NHHDPRMMKVKFG-------------------------------------- 242

  Fly   258 NLMKRIKGGAFLTDILNKM-QNKRKRNLNPDR-----KIFLYSGHDVTLVNVMNSLGILDQTT-- 314
            |||..:     ||||.||: .:|.:::.:..|     |:.:||..|..|:.|::||.:|:||.  
 Worm   243 NLMNTL-----LTDIKNKIYMDKEEKHKSDGRVSRREKLAVYSTQDWILMGVLDSLNVLEQTVGL 302

  Fly   315 -KLPEYASALAFELHHSKSFSD-GDFEVKLVYYYNSEDKFPKELTIPNCDAPCSLTQFEASVK-- 375
             |.|||.|.:.||     ::.| |.:.||:  :|..|     |:|..:.:. ..:|:|..:.|  
 Worm   303 DKYPEYNSMIIFE-----TWKDNGKYFVKV--FYKKE-----EITAEDHEL-IDVTKFVRNCKRE 354

  Fly   376 ALLLDNYDETCENH 389
            ..|..::.:.|:::
 Worm   355 RCLAQDFLDCCDDY 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6656NP_650991.1 HP_HAP_like 41..344 CDD:132717 92/355 (26%)
acp-2NP_495774.1 HP_HAP_like 29..329 CDD:132717 92/357 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3720
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221585at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R958
SonicParanoid 1 1.000 - - X4294
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.