DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cby and Cby1

DIOPT Version :10

Sequence 1:NP_650989.7 Gene:Cby / 42574 FlyBaseID:FBgn0067317 Length:133 Species:Drosophila melanogaster
Sequence 2:NP_082910.1 Gene:Cby1 / 73739 MGIID:1920989 Length:127 Species:Mus musculus


Alignment Length:117 Identity:43/117 - (36%)
Similarity:66/117 - (56%) Gaps:12/117 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 MPLFNKKFESKPIPVRQGR--CNIGHPV--ATEDLD---DFRQISLTLGNKELRFADGIWM-HST 82
            ||||...|..|..|.|:..  .|: |.:  :|.:|:   |:...::.|..:.|:|.:|.|: .|.
Mouse     1 MPLFGSIFSPKKTPPRKSASLSNL-HSLDRSTRELELGLDYGTPTMNLAGQSLKFENGQWVADSV 64

  Fly    83 RKGDVD--DMLRLNKKFRALEEENNMCNLKIEVMLDLLAEHATELSELKPKE 132
            ..|.||  :..||.|:.:.||||||:..||::::||:|:|...| |.||.||
Mouse    65 ISGGVDRRETQRLRKRNQQLEEENNLLRLKVDILLDMLSETTAE-SHLKDKE 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CbyNP_650989.7 Cby_like 26..124 CDD:143631 37/107 (35%)
Cby1NP_082910.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25 9/24 (38%)
Chibby 2..115 CDD:464233 40/114 (35%)
Minimal region for the interaction with PKD2. /evidence=ECO:0000250|UniProtKB:Q9Y3M2 60..112 21/52 (40%)
Leucine-zipper, mediates homodimerization. /evidence=ECO:0000250|UniProtKB:Q9Y3M2 77..98 10/20 (50%)

Return to query results.
Submit another query.