DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cby and Cby3

DIOPT Version :9

Sequence 1:NP_650989.6 Gene:Cby / 42574 FlyBaseID:FBgn0067317 Length:132 Species:Drosophila melanogaster
Sequence 2:XP_038943109.1 Gene:Cby3 / 690544 RGDID:1594715 Length:240 Species:Rattus norvegicus


Alignment Length:127 Identity:30/127 - (23%)
Similarity:50/127 - (39%) Gaps:31/127 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 FNKKFESKPIPVRQGRCNIGHPVATED--LDDFR----QISLTLGNKELRFAD-------GIWMH 80
            |:::|..:..|:|       |..:|..  |.|:|    ::.|:.|....|.:|       |.|..
  Rat    84 FSRRFSPRRPPLR-------HISSTSTFYLLDYRTRQAELGLSYGAPRTRLSDEAFVFRGGRWTA 141

  Fly    81 STRKGDVDDMLRLNK-----------KFRALEEENNMCNLKIEVMLDLLAEATELSELKPKE 131
            ..:.......|....           |.:.|.||||...|:.|:::|:|.|.|...:|..|:
  Rat   142 EGKGARARTSLPSPTTPTWKPQGQPIKSQVLLEENNYLKLQQELLMDMLTETTARMQLLEKK 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CbyNP_650989.6 None
Cby3XP_038943109.1 Chibby 83..202 CDD:405348 29/124 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21533
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.