DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cby and Cby2

DIOPT Version :9

Sequence 1:NP_650989.6 Gene:Cby / 42574 FlyBaseID:FBgn0067317 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001157611.1 Gene:Cby2 / 67926 MGIID:1915176 Length:446 Species:Mus musculus


Alignment Length:140 Identity:29/140 - (20%)
Similarity:49/140 - (35%) Gaps:44/140 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PLFNKKFESKPI-PVRQGRCNIGHPVATEDLD-DFRQISLTLGNKELRFADGIW----------- 78
            ||  .:|.|.|. |:.:       |.:..||: |:....:.|.::...|.||.|           
Mouse    90 PL--NRFSSMPFDPMER-------PTSQADLELDYNPPRVQLSDEMFVFQDGRWVNESCRLQPPY 145

  Fly    79 ----------MHSTRKGDVDDMLRLNKKF----RALEEENNMCNLKIEVM--------LDLLAEA 121
                      :|..|......:...||..    |||.:||.....:.:::        :.|..|.
Mouse   146 FSPPSSFHHKLHHRRLAKEYQLQEENKSLRDENRALRDENKALRKENKILQVFWEEHKVTLGHEE 210

  Fly   122 TELSELKPKE 131
            ::.|.|..|:
Mouse   211 SQTSSLLHKD 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CbyNP_650989.6 None
Cby2NP_001157611.1 Cby_like 76..191 CDD:143631 24/109 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 208..243 4/13 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 268..317
Cby_like 302..424 CDD:299860
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21533
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.