DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cby and SPBC337.02c

DIOPT Version :9

Sequence 1:NP_650989.6 Gene:Cby / 42574 FlyBaseID:FBgn0067317 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001343044.1 Gene:SPBC337.02c / 3361275 PomBaseID:SPBC337.02c Length:305 Species:Schizosaccharomyces pombe


Alignment Length:82 Identity:20/82 - (24%)
Similarity:35/82 - (42%) Gaps:29/82 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 ELRFADGI--WMHSTRKGDV--------DDMLR-LNKKFRALEEE-----NNMCNLKIEVM---- 114
            |::|...|  |. :|:.|.:        |.|.. :|.:|.|::.|     ..|..:|:|::    
pombe    89 EVQFPRWIDEWA-NTKLGGIFERIFSKMDSMQNDMNSRFDAMQNEMTSMKGEMAEMKVEMVEMKR 152

  Fly   115 --------LDLLAEATE 123
                    :|||.:.||
pombe   153 ETIRLNTRIDLLEQKTE 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CbyNP_650989.6 None
SPBC337.02cNP_001343044.1 SMC_N 27..>207 CDD:330553 20/82 (24%)
DUF1773 212..268 CDD:312190
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR21533
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.