DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cby and cby1

DIOPT Version :9

Sequence 1:NP_650989.6 Gene:Cby / 42574 FlyBaseID:FBgn0067317 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001003838.1 Gene:cby1 / 326875 ZFINID:ZDB-GENE-030131-5074 Length:125 Species:Danio rerio


Alignment Length:115 Identity:42/115 - (36%)
Similarity:66/115 - (57%) Gaps:11/115 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 MPLFNKKFESKPIPVRQGR--CNIGHPV--ATEDLD---DFRQISLTLGNKELRFADGIWMHSTR 83
            ||||...|..|..|.|:..  .|: |.:  :|.:::   ::....:.:|.:.|:|.||.|: |..
Zfish     1 MPLFGNIFSPKKTPPRKSASLSNL-HTLDRSTREIELGLEYGSPVMNIGGQSLKFEDGQWI-SES 63

  Fly    84 KGDVD--DMLRLNKKFRALEEENNMCNLKIEVMLDLLAEATELSELKPKE 131
            .|:|.  ::.||.|:...||||||:..|||||:||:|:|:|..:.|..||
Zfish    64 GGNVSGKEVQRLKKRNLQLEEENNLLRLKIEVLLDMLSESTAETHLVQKE 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CbyNP_650989.6 None
cby1NP_001003838.1 Chibby 1..112 CDD:291318 40/112 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I11035
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I5409
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1492677at2759
OrthoFinder 1 1.000 - - FOG0007162
OrthoInspector 1 1.000 - - oto39340
orthoMCL 1 0.900 - - OOG6_108796
Panther 1 1.100 - - LDO PTHR21533
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4979
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1010.000

Return to query results.
Submit another query.