DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cby and CBY1

DIOPT Version :9

Sequence 1:NP_650989.6 Gene:Cby / 42574 FlyBaseID:FBgn0067317 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001002880.3 Gene:CBY1 / 25776 HGNCID:1307 Length:126 Species:Homo sapiens


Alignment Length:116 Identity:38/116 - (32%)
Similarity:66/116 - (56%) Gaps:11/116 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 MPLFNKKFESKPIPVRQGR--CNIGHPV--ATEDLD---DFRQISLTLGNKELRFADGIWMHSTR 83
            ||.|...|..|..|.|:..  .|: |.:  :|.:::   ::...::.|..:.|:|.:|.|:..|.
Human     1 MPFFGNTFSPKKTPPRKSASLSNL-HSLDRSTREVELGLEYGSPTMNLAGQSLKFENGQWIAETG 64

  Fly    84 -KGDVD--DMLRLNKKFRALEEENNMCNLKIEVMLDLLAEATELSELKPKE 131
             .|.||  ::.||.::.:.||||||:..||::::||:|:|:|..|.|..||
Human    65 VSGGVDRREVQRLRRRNQQLEEENNLLRLKVDILLDMLSESTAESHLMEKE 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CbyNP_650989.6 None
CBY1NP_001002880.3 Chibby 1..114 CDD:405348 36/113 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26 8/25 (32%)
Minimal region for the interaction with PKD2. /evidence=ECO:0000269|PubMed:15194699 60..112 20/51 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I11361
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I5420
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1492677at2759
OrthoFinder 1 1.000 - - FOG0007162
OrthoInspector 1 1.000 - - oto90677
orthoMCL 1 0.900 - - OOG6_108796
Panther 1 1.100 - - LDO PTHR21533
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.970

Return to query results.
Submit another query.