DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cby and SPCC569.03

DIOPT Version :9

Sequence 1:NP_650989.6 Gene:Cby / 42574 FlyBaseID:FBgn0067317 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_588570.2 Gene:SPCC569.03 / 2538960 PomBaseID:SPCC569.03 Length:375 Species:Schizosaccharomyces pombe


Alignment Length:169 Identity:35/169 - (20%)
Similarity:60/169 - (35%) Gaps:67/169 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PLPFKQLFAMPLFNKKFE----SKPIPVRQGRCNIGHPVATEDLDDFRQIS-------------- 63
            |.|......:.||.||||    |..:...:..        .|.:::|||..              
pombe    14 PPPDDSAEDLKLFIKKFERSLNSALLEFDENN--------QETIENFRQAKEHKMRFETECDQKL 70

  Fly    64 -----LTLGNK-------ELRFADGI--WMHSTRKGDV--------DDMLR-LNKKFRALEEE-- 103
                 |.:..:       |::|...|  |. :|:.|.:        |.|.. :|.:|.|::.|  
pombe    71 RNWKRLAIEREVSEEQSGEVQFPRWIDEWA-NTKLGGIFERIFSKMDSMQNDMNSRFDAMQTEMS 134

  Fly   104 ---NNMCNLKIEVMLDLLAEAT-----------ELSELK 128
               |.:.::|.| |.::..|.|           |::|:|
pombe   135 VMKNGIASIKGE-MAEMKGEMTVMKNDIASIKGEMAEMK 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CbyNP_650989.6 None
SPCC569.03NP_588570.2 PEARLI-4 <153..231 CDD:253129 5/20 (25%)
DUF1773 282..338 CDD:285759
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21533
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.