DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lsn and VPS22

DIOPT Version :9

Sequence 1:NP_650987.1 Gene:lsn / 42572 FlyBaseID:FBgn0260940 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001119065.1 Gene:VPS22 / 828812 AraportID:AT4G27040 Length:250 Species:Arabidopsis thaliana


Alignment Length:242 Identity:108/242 - (44%)
Similarity:151/242 - (62%) Gaps:7/242 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRRRVGLGAIQQQKLAAEKYKDKGTDLQENQLEQMTKQMEVFRVKLEEFAMKHKEDIRKNSQFRK 65
            ||||.|:|.:|:...|.::|:..|.::.:.:.:.|.:|:..||.:|||||.|||.|||||..||.
plant     1 MRRRPGIGGLQKAAAARDQYRLLGENVAKLRTDMMKEQLSTFRSQLEEFARKHKNDIRKNPAFRA 65

  Fly    66 QFQEMCAAIGVDPLATGKGFWS-VLGMGDFYYELGVQVVEVCLAANHKTGGLMELDDLRRRLIAA 129
            ||.||||.|||||||:.||||: :||:||||||||||::|||:......|||:.|.:|...|...
plant    66 QFHEMCANIGVDPLASNKGFWAELLGIGDFYYELGVQIIEVCMLTRSHNGGLISLQELCNHLRQR 130

  Fly   130 RGQSSVHQEITKEDILMAAKKLSIFGNGFVVHKLGKGKYIVQSIPGELSMEETNILNAASNTEQG 194
            |.:.  .:.:|::|.|.|..||.:.|:||.|..:|| |.:|:|:|.||:.:...||..|..  ||
plant   131 RKKD--REAVTEDDCLRAISKLKVLGSGFEVITIGK-KKLVRSVPTELNKDHNQILELAQG--QG 190

  Fly   195 CVTQSQLIKDLGWTDYRAQQSLDKVLGEGLCWIDKQAGD-EPAYWFP 240
            .|...::.:.|.||..|...:|:.:|.|||..||....| :..||||
plant   191 FVIVEEVQRRLSWTSGRVIDALETLLEEGLAMIDNGHKDGKCRYWFP 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lsnNP_650987.1 EAP30 6..228 CDD:282067 97/222 (44%)
VPS22NP_001119065.1 EAP30 5..225 CDD:398021 98/224 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 185 1.000 Domainoid score I1003
eggNOG 1 0.900 - - E1_KOG3341
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5239
Inparanoid 1 1.050 198 1.000 Inparanoid score I1329
OMA 1 1.010 - - QHG54473
OrthoDB 1 1.010 - - D869548at2759
OrthoFinder 1 1.000 - - FOG0004178
OrthoInspector 1 1.000 - - otm3491
orthoMCL 1 0.900 - - OOG6_102942
Panther 1 1.100 - - LDO PTHR12806
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3997
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.