DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lsn and Snf8

DIOPT Version :9

Sequence 1:NP_650987.1 Gene:lsn / 42572 FlyBaseID:FBgn0260940 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_006533530.1 Gene:Snf8 / 27681 MGIID:1343161 Length:275 Species:Mus musculus


Alignment Length:216 Identity:113/216 - (52%)
Similarity:161/216 - (74%) Gaps:6/216 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RRRVGLGAIQQQKLAAEKYKDKGTDLQENQLEQMTKQMEVFRVKLEEFAMKHKEDIRKNSQFRKQ 66
            ||.||.|||.::|||..|||::||.|.|:||.||:||:::|:..|||||.|||::||||.:||.|
Mouse     3 RRGVGAGAIAKKKLAEAKYKERGTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEIRKNPEFRVQ 67

  Fly    67 FQEMCAAIGVDPLATGKGFWS-VLGMGDFYYELGVQVVEVCLAANHKTGGLMELDDLRRRLIAAR 130
            ||:|||.|||||||:|||||| :||:||||||||||::|||||..|:.|||:.|::|.::::..|
Mouse    68 FQDMCATIGVDPLASGKGFWSEMLGVGDFYYELGVQIIEVCLALKHRNGGLITLEELHQQVLKGR 132

  Fly   131 GQSSVHQEITKEDILMAAKKLSIFGNGFVVHKLGKGKYIVQSIPGELSMEETNILNAASNTEQGC 195
            |:.:  |:::::|::.|.|||...|.||.:..:| |.|::||:|.||:|:.|.:|..|.  :.|.
Mouse   133 GKFA--QDVSQDDLIRAIKKLKALGTGFGIIPVG-GTYLIQSVPAELNMDHTVVLQLAE--KNGY 192

  Fly   196 VTQSQLIKDLGWTDYRAQQSL 216
            ||.|::...|.|...||:|.|
Mouse   193 VTVSEIKTSLKWETERARQVL 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lsnNP_650987.1 EAP30 6..228 CDD:282067 110/212 (52%)
Snf8XP_006533530.1 EAP30 6..213 CDD:367847 110/211 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848202
Domainoid 1 1.000 238 1.000 Domainoid score I2299
eggNOG 1 0.900 - - E1_KOG3341
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5239
Inparanoid 1 1.050 259 1.000 Inparanoid score I3122
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54473
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004178
OrthoInspector 1 1.000 - - oto93935
orthoMCL 1 0.900 - - OOG6_102942
Panther 1 1.100 - - LDO PTHR12806
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3694
SonicParanoid 1 1.000 - - X3997
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.