DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr93a and Gr98a

DIOPT Version :9

Sequence 1:NP_524442.2 Gene:Gr93a / 42568 FlyBaseID:FBgn0041229 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_651564.1 Gene:Gr98a / 43305 FlyBaseID:FBgn0039520 Length:391 Species:Drosophila melanogaster


Alignment Length:349 Identity:62/349 - (17%)
Similarity:131/349 - (37%) Gaps:63/349 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 ESYADVLALAQSMSVSILAVISFVIQARGENQFREVLNRYLALYQRICL-------TTRLRHL-- 141
            :.::..:.|:..::: :|.....|::....|..::|..:..|::.:|.|       |.|:|..  
  Fly    67 DRFSSTIDLSNFVAL-VLGHAIIVLELLWGNCSKDVDRQLQAIHSQIKLQLGTSNSTDRVRRYCN 130

  Fly   142 -----FPTKFVVFFLLKLF----FTLCGCFHEIIPLFENSHFDDISQMVGTGFGIYMWLGTLCVL 197
                 ...::::|.::.::    .|:...:.|::.|   :.|.:.:........||..|      
  Fly   131 WIYGSLIIRWLIFIVVTIYSNRALTINATYSELVFL---ARFSEFTLYCAVILFIYQEL------ 186

  Fly   198 DACFLGFLVSGILYEHMANNIIAMLKRMEPIESQDERYRMTKYRRMQLLCDFADELDECAAIYSE 262
                   :|.|       :|::..|.|        .||.|...||:.|     .:|.:..||::.
  Fly   187 -------IVGG-------SNVLDELYR--------TRYEMWSIRRLSL-----QKLAKLQAIHNS 224

  Fly   263 LYHVTNSFRRILQWQILFYIYLNFINICLMLYQYILHFLNDDEVVFVSIVMAFVKLANLVLLMMC 327
            |:..........|..::..:...||:...:.|...|..:....|.....|.....:..|.:::.|
  Fly   225 LWQAIRCLECYFQLSLITLLMKFFIDTSALPYWLYLSRVEHTRVAVQHYVATVECIKLLEIVVPC 289

  Fly   328 ADYTVRQSEVPKKLPLDIVCSDMDERWDKSVETFLG----QLQTQRLEIKVLGFFHLNNEFILLI 388
              |...:.:..::..|.:..:...:|....:...|.    ||..::.:....|...:|.|.:...
  Fly   290 --YLCTRCDAMQRKFLSMFYTVTTDRRSSQLNAALRSLNLQLSQEKYKFSAGGMVDINTEMLGKF 352

  Fly   389 LSAIISYLFILIQFGITGGFEASE 412
            ...:|||:.|.|||.|  .|.|.:
  Fly   353 FFGMISYIVICIQFSI--NFRAKK 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr93aNP_524442.2 7tm_7 46..405 CDD:303125 59/340 (17%)
Gr98aNP_651564.1 7tm_7 13..370 CDD:285581 60/343 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.