DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr93a and Gr59f

DIOPT Version :9

Sequence 1:NP_524442.2 Gene:Gr93a / 42568 FlyBaseID:FBgn0041229 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster


Alignment Length:421 Identity:89/421 - (21%)
Similarity:166/421 - (39%) Gaps:94/421 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LYRCARGLLVLSSSLDRDKLQLKATKQGSRNRF---LHILWRCIVVMIYAGLWPMLTSAVIGKRL 85
            |||....||::|...:...:.:   ..|..|||   :|:.|    ::::.||:      |:|   
  Fly    33 LYRTLFWLLLISVLANTAPITI---LPGCPNRFYRLVHLSW----MILWYGLF------VLG--- 81

  Fly    86 ESYAD-VLALAQSMS--------------VSILAVISFVIQARG------ENQFREVLNRYLALY 129
             ||.: ||...|.:|              |.|.:::....|.|.      .|.....|||   .|
  Fly    82 -SYWEFVLVTTQRVSLDRYLNAIESAIYVVHIFSIMLLTWQCRNWAPKLMTNIVTSDLNR---AY 142

  Fly   130 QRICLTTRLRHLFPTKFVVFFLLKLFFTLCGCFHEIIPLFEN--SHFDDISQMVGTGFGIYMWLG 192
            ...|..|:.          |..|:||  |.|.| ..:.:|.|  :|          .|.:|.   
  Fly   143 TIDCNRTKR----------FIRLQLF--LVGIF-ACLAIFFNIWTH----------KFVVYR--- 181

  Fly   193 TLCVLDACFLGFLVSGILYE--HMANNIIAMLKRMEPIESQDERYRMTKYRRMQLLCDFADELDE 255
            ::..:::..:..::|.|.:.  ::....||..:|           |:|:....:|....:..:.|
  Fly   182 SILSINSYVMPNIISSISFAQYYLLLQGIAWRQR-----------RLTEGLERELTHLHSPRISE 235

  Fly   256 CAAI---YSELYHVTNSFRRILQWQILFYI---YLNFINICLMLYQYILHFLNDDEVVFVSIVMA 314
            ...|   ::.|...|.:..|..|:.||...   :|||..:..::||.|.:....|...:|.:::.
  Fly   236 VQKIRMHHANLIDFTKAVNRTFQYSILLLFVGCFLNFNLVLFLVYQGIENPSMADFTKWVCMLLW 300

  Fly   315 FVKLANLVLLMMCADYTVRQSEVPKKLPLDIVCSDMDERWDKSVETFLGQLQTQRLEIKVLGFFH 379
            .......|..::..:.:: |:|....|.|....|...:....::..|:.|::|...:..|.|..:
  Fly   301 LAMHVGKVCSILHFNQSI-QNEHSTCLTLLSRVSYARKDIQDTITHFIIQMRTNVRQHVVCGVIN 364

  Fly   380 LNNEFILLILSAIISYLFILIQFGITGGFEA 410
            |:.:|:..:|.|...:...|:|:.:|  :||
  Fly   365 LDLKFLTTLLVASADFFIFLLQYDVT--YEA 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr93aNP_524442.2 7tm_7 46..405 CDD:303125 80/392 (20%)
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 78/381 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.