DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr93a and Gr9a

DIOPT Version :9

Sequence 1:NP_524442.2 Gene:Gr93a / 42568 FlyBaseID:FBgn0041229 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_727392.1 Gene:Gr9a / 318158 FlyBaseID:FBgn0052693 Length:341 Species:Drosophila melanogaster


Alignment Length:358 Identity:77/358 - (21%)
Similarity:137/358 - (38%) Gaps:104/358 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 LNRYLALYQRIC------LTTRLRHLFPTKFVVFFLLKL------FFTLCGCFHEIIP------- 167
            |..:|..|.::|      ..:||..|..:.|:|..|::|      :||.....:|.:|       
  Fly     5 LEHFLTGYFQLCGLVCGWSGSRLGRLLSSTFLVLILIELVGEIETYFTEENPDNESVPAYFAKVI 69

  Fly   168 ------------------LFENSHF----DDISQMVGTGFGIYMWLGTLCVLDAC--FL---GFL 205
                              |||...|    :::..:..|.| ||..|....:|.||  ||   .:.
  Fly    70 MGVNMAYKMIHAWIALSALFECRRFRYLLEELPPVKATSF-IYRHLILEIILFACNAFLVLSEYT 133

  Fly   206 VSGILYEHM--ANNIIAM----LKRMEPIESQDERYRMTKYRRMQLLCDFAD-ELDECAAIYSEL 263
            :.||..|::  |.::.|:    |:.|..::..|.:.....:|.:....|:.. .||     |:.|
  Fly   134 IRGIYLENLRYAYSLQAVRARYLQMMVLVDRLDGKLEQLHHRVISGSSDYKTLRLD-----YAHL 193

  Fly   264 YHVTNSFRRILQWQILFYIYLNFINICLMLYQYIL----HFLNDDEVVFVSIVMAFVKLANLVLL 324
            ..||.|...      ||.:.|..:|: |.|..:|:    :|:    |.::.::.|.:.|...|:.
  Fly   194 AKVTRSLSH------LFGLSLLLLNV-LCLGDWIIVCNVYFM----VAYLQVLPATLFLFGQVMF 247

  Fly   325 MMCADYTVRQSEVPKKLPLDIVCSDMDERWDKS--------------------VETFLGQLQTQR 369
            ::|          |..:.:..:|:.......||                    :|.|..|:....
  Fly   248 VVC----------PTLIKIWSICAASHRCVSKSKHLQQQLKDLPGQTPVERSQIEGFALQIMQDP 302

  Fly   370 LEIKVLGFFHLNNEFILLILSAIISYLFILIQF 402
            ::|.|.|.:|||.:.:..:...|:..|.|.:||
  Fly   303 IQIDVCGIYHLNLQTLAGMFFFILEALVIFLQF 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr93aNP_524442.2 7tm_7 46..405 CDD:303125 77/358 (22%)
Gr9aNP_727392.1 7tm_7 7..335 CDD:285581 74/354 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.