DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr93a and Gr36b

DIOPT Version :9

Sequence 1:NP_524442.2 Gene:Gr93a / 42568 FlyBaseID:FBgn0041229 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_724039.1 Gene:Gr36b / 117487 FlyBaseID:FBgn0045486 Length:391 Species:Drosophila melanogaster


Alignment Length:380 Identity:82/380 - (21%)
Similarity:151/380 - (39%) Gaps:70/380 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 RCIVVMIYAGLWPMLTSAVIGKRLESYADVLALAQSMS---------VSILAVISFVIQARGENQ 117
            ||.:....|.::.::|   |.....::.|...|.||.:         :|.|.:::.:|       
  Fly    38 RCTIYAFMANIFILIT---IIYNFTAHGDTNLLFQSANKLHEYVIIIMSGLKIVAGLI------- 92

  Fly   118 FREVLNRYLALYQRICLTTRLRHLF----PTKFVVFF--LLKLFFTLCGCFHEIIPLFENSHFDD 176
              .||||:|...|.:.|...:..|:    ..|.::.:  |||.|.:..      |.|.:.:...|
  Fly    93 --TVLNRWLQRGQMMQLVKDVIRLYMINPQLKSMIRWGILLKAFISFA------IELLQVTLSVD 149

  Fly   177 ISQMVGTG--FGIYMWLGTLCVLDACFLGFLVSGILYEHMANNIIAMLKRMEPIESQDERYRMTK 239
            .....||.  .|:   |..|||      .|:::..:.:|..  :|.:::....|.:...|..:.:
  Fly   150 ALDRQGTAEMMGL---LVKLCV------SFIMNLAISQHFL--VILLIRAQYRIMNAKLRMVIEE 203

  Fly   240 YRRMQLL-----------CDFADELDECAAIYSELYHVTNSFRRILQWQ-ILFY--IYLNFINIC 290
            .||:..|           |..:|:|::...:.|:|..:......:...| ::.|  .||:.:...
  Fly   204 SRRLSFLQLRNGAFMTRCCYLSDQLEDIGEVQSQLQSMVGQLDEVFGMQGLMAYSEYYLSIVGTS 268

  Fly   291 LM---LYQYILHFLNDDEVVFVSIVMAFVKLANLVLLMMCADYTVRQSEVPKKL-----PLDIVC 347
            .|   :|:|..|.|.......: ||...:.|..|..|:.| :..:|..:..|..     ...:..
  Fly   269 YMSYSIYKYGPHNLKLSAKTSI-IVCILITLFYLDALVNC-NNMLRVLDHHKDFLGLLEERTVFA 331

  Fly   348 SDMDERWDKSVETFLGQLQTQRLEIKVLGFFHLNNEFILLILSAIISYLFILIQF 402
            |.:|.|.::|.|:...||....|:|.|:|.|.:.......:.:::|.....||||
  Fly   332 SSLDIRLEESFESLQLQLARNPLKINVMGMFPITRGSTAAMCASVIVNSIFLIQF 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr93aNP_524442.2 7tm_7 46..405 CDD:303125 82/380 (22%)
Gr36bNP_724039.1 7tm_7 9..390 CDD:285581 82/380 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.