DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr93a and Gr59b

DIOPT Version :9

Sequence 1:NP_524442.2 Gene:Gr93a / 42568 FlyBaseID:FBgn0041229 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_523818.2 Gene:Gr59b / 117484 FlyBaseID:FBgn0045482 Length:366 Species:Drosophila melanogaster


Alignment Length:400 Identity:75/400 - (18%)
Similarity:160/400 - (40%) Gaps:104/400 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 TKQGSRNRFLHILWR---------CIVVMIYAGLWPMLTSAVIGKRLESYADVLALAQSM--SVS 101
            ::|.|..:|...|:.         ..::|:...:|.:   .::.::.:::..::.:..::  :||
  Fly    20 SQQFSNRKFFSTLFSRTYALIANIVTLIMLPIVMWQV---QLVFQQKKTFPKLILITNNVREAVS 81

  Fly   102 ILAVISFVIQARG--ENQFREVLNRYLALY--QRIC-------LTTRLRHLFPTKFVVFFLLK-- 153
            .| ||.:.:.:||  :..|:|:....|.|:  ::.|       :...||.|.   ||.||.|.  
  Fly    82 FL-VILYTVLSRGFRDTAFKEMQPLLLTLFREEKRCGFKGIGGVRRSLRILL---FVKFFTLSWL 142

  Fly   154 --------LFFTLCGCFHEIIPLFENSHFDDISQMVGTGFGIYMWLGTLCVLDACFLGFLVSGIL 210
                    |:.|....:..::..|...:.::|.:||..|:.:.:|                    
  Fly   143 CVTDVLFLLYSTDALIWVNVLRFFFKCNTNNILEMVPMGYFLALW-------------------- 187

  Fly   211 YEHMANNIIAMLKRMEPI-ESQDERYRMTKYRRMQLLCDFADELDECAAIYSELYHVTNSFRRIL 274
              |:|.....:.:|::.| :|:..|    |:|.:|.|.          .:::.|.....:..:|.
  Fly   188 --HIARGFDCVNRRLDQIVKSKSTR----KHRELQHLW----------LLHACLTKTALNINKIY 236

  Fly   275 QWQILFYIYLNFINICLMLYQYILHFLNDDEVVFVSIVMAFVKLANLVLLMMCADYTVRQSEVPK 339
            ..|:|...:.||:|..:..|...: |..|....|..:|...|:..     :.|.||.:       
  Fly   237 APQMLASRFDNFVNGVIQAYWGAV-FTFDLSTPFFWVVYGSVQYH-----VRCLDYYL------- 288

  Fly   340 KLPLDIVC------------SDMDERWDKSVETFLGQLQTQRLEIKVLGFFHLNNEFILLILSAI 392
               :|.:|            |..:.||.|.:.:::....:.:|::...|.|..|......::|::
  Fly   289 ---IDNMCDVAVEYHDSAKHSWSEVRWTKEISSYVIYANSTKLQLWSCGLFQANRSMWFAMISSV 350

  Fly   393 ISYLFILIQF 402
            :.|:.:|:||
  Fly   351 LYYILVLLQF 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr93aNP_524442.2 7tm_7 46..405 CDD:303125 74/399 (19%)
Gr59bNP_523818.2 7tm_7 6..364 CDD:285581 74/399 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.