DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr93a and Gr22f

DIOPT Version :9

Sequence 1:NP_524442.2 Gene:Gr93a / 42568 FlyBaseID:FBgn0041229 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_722729.2 Gene:Gr22f / 117349 FlyBaseID:FBgn0041249 Length:378 Species:Drosophila melanogaster


Alignment Length:430 Identity:84/430 - (19%)
Similarity:151/430 - (35%) Gaps:138/430 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 QGSRNRFLHILWRCIVVMIYA----GLWPMLTSA------------VIGKRLESYADVLALAQSM 98
            |..|....|:.|..:...:||    ||:|....:            :.|..|.|.|..||::..:
  Fly     5 QPRRGFSCHLAWFMLQTTLYASWLLGLFPFTFDSRRKQLKRSRWLLLYGFVLHSLAMCLAMSSHL 69

  Fly    99 S------------------------VSILAVIS--FVIQARGENQFREVLNRYLALYQRICLTTR 137
            :                        |:....||  .::.....|..|::.|..|.|..::     
  Fly    70 ASKQRRKYNAFERNPLLEKIYMQFQVTTFFTISVLLLMNVWKSNTVRKIANELLTLEGQV----- 129

  Fly   138 LRHLFPTK-------FVV--------FFLLKLFFTLCGCFHEIIPLFENSHFDDISQMVGTGFGI 187
             :.|...|       ||:        .|::.::|.||.         ||| :..|          
  Fly   130 -KDLLTLKNCPNFNCFVIKKHVAAIGQFVISIYFCLCQ---------ENS-YPKI---------- 173

  Fly   188 YMWLGTLCVLDACFLGFLVSGILYEHMANNIIAMLKRMEPI-ESQDERYRMTKYRRMQLLCDFAD 251
               |..||.|.:..|..::.     |....||.:.:.:..: |:.::.:.::. .|:..|....|
  Fly   174 ---LKILCCLPSVGLQLIIM-----HFHTEIILVYRYVWLVNETLEDSHHLSS-SRIHALASLYD 229

  Fly   252 ELDECAAIYSELYHVTNSFRRILQWQILFYIYLNFINICLMLYQYILHFLNDDEVVFVSIVMAFV 316
            .|.:    .|||....|..:.||  .::.|:..|.:.|..::            |:.||:...::
  Fly   230 RLLK----LSELVVACNDLQLIL--MLIIYLIGNTVQIFFLI------------VLGVSMNKRYI 276

  Fly   317 KLA--------------NLV---LLMMCADYTVRQSEVPKKLPLDIVCSDMDERWDKSVETFLGQ 364
            .|.              |:|   |...|.|.|.:..::...|..|      ||..::|:..|...
  Fly   277 YLVASPQLIINFWDFWLNIVVCDLAGKCGDQTSKVLKLFTDLEHD------DEELERSLNEFAWL 335

  Fly   365 LQTQRLEIKVLGFFHLNNE--FILLILSAIISYLFILIQF 402
            ...::...::.|.|.:|:.  |.::|.|.:  ||..|:||
  Fly   336 CTHRKFRFQLCGLFSINHNMGFQMIITSFL--YLVYLLQF 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr93aNP_524442.2 7tm_7 46..405 CDD:303125 84/430 (20%)
Gr22fNP_722729.2 7tm_7 19..377 CDD:285581 80/416 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.