DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr93a and Gr39b

DIOPT Version :9

Sequence 1:NP_524442.2 Gene:Gr93a / 42568 FlyBaseID:FBgn0041229 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_724336.1 Gene:Gr39b / 117347 FlyBaseID:FBgn0041245 Length:369 Species:Drosophila melanogaster


Alignment Length:439 Identity:79/439 - (17%)
Similarity:150/439 - (34%) Gaps:145/439 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LLLWLYRCARGLL---VLSSSLDRDKLQLKATKQG-------SRNRFLHILWR---------CIV 65
            |:.|...||:...   |.|:.|    :.|.|...|       |...||.::..         |:.
  Fly    17 LVPWSESCAQSKFVQKVYSAIL----IILNAVHFGISIYFPQSAELFLSLMVNVIVFVARIVCVT 77

  Fly    66 VMI------------------YAGLWPMLTSAV-IGK-RLESYADVLALAQSMSVSILAVISFVI 110
            |:|                  |.||.......: :|: :.:|||.:|||.....|::|..|    
  Fly    78 VIILQVMVHYDDYFRFCREMKYLGLRLQCELKIHVGRLKWQSYAKILALGIGFLVTVLPSI---- 138

  Fly   111 QARGENQFREVLNRYLALYQRICLTTRLRHLFPTKFVVFFLLKLFFTLCGCFHEIIPLFENSHFD 175
                          |:||...:.       .|.:..:...::::.|.|.....|::     .|..
  Fly   139 --------------YVALSGSLL-------YFWSSLLSILIIRMQFVLVLLNVELL-----GHHV 177

  Fly   176 DISQMVGTGFGIYM-------WLGTLCVLDA-----CFLGFLVSGILYEHMANNIIAMLKRMEPI 228
            .:       .||.:       .:|..|.||.     |.|.||:: :...||              
  Fly   178 SL-------LGIRLQNVLECHLMGANCTLDGNANRLCSLEFLLA-LKQSHM-------------- 220

  Fly   229 ESQDERYRMTKYRRMQLLCDFADELDECAAIYSELYHVTNSFRRILQWQILFYIYLNFINICLML 293
                                             :|:::...|..:..|.||....:.|.:..:.:
  Fly   221 ---------------------------------QLHYLFTHFNDLFGWSILGTYVVLFSDSTVNI 252

  Fly   294 Y--QYILHFLNDDEVVFVSIVMAFVKLANLVLLMMCADYTVRQSEVPKKLPLDIVCS---DMDER 353
            |  |.:|..:.:.:.::.:..:......|:::...|.::..|||.:......::.|.   ..:..
  Fly   253 YWTQQVLVEVYEYKYLYATFSVFVPSFFNILVFCRCGEFCQRQSVLIGSYLRNLSCHPSIGRETS 317

  Fly   354 WDKSVETFLGQLQTQRLEIKVLGFFHLNNEFILLILSAIISYLFILIQF 402
            :...:..|:.|::...|.|...||...:|..::.||:|.::||.:|:||
  Fly   318 YKDLLMEFILQVEQNVLAINAEGFMSTDNSLLMSILAAKVTYLIVLMQF 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr93aNP_524442.2 7tm_7 46..405 CDD:303125 71/410 (17%)
Gr39bNP_724336.1 7tm_7 5..367 CDD:303125 79/439 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.