DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr93a and Gr97a

DIOPT Version :9

Sequence 1:NP_524442.2 Gene:Gr93a / 42568 FlyBaseID:FBgn0041229 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_001287551.1 Gene:Gr97a / 117338 FlyBaseID:FBgn0041224 Length:425 Species:Drosophila melanogaster


Alignment Length:434 Identity:87/434 - (20%)
Similarity:165/434 - (38%) Gaps:84/434 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LDRDKLQLKATKQGS-----RNRFLHILWRCIVVMIYAGLWPMLTSAVIGKRLESYADVLALAQS 97
            |.|...:|::..|.|     |...||.  :.:.:.:||.::..:...|...|..........::.
  Fly     4 LRRQTRRLRSIWQRSLPVRFRRGKLHT--QLVTICLYATVFLNILYGVYLGRFSFRRKKFVFSKG 66

  Fly    98 MSVSILAVISFVIQ----------ARGENQFREVLNRYLALYQRICLTTRLRHLFPTKFVVFFLL 152
            :::..|.|.:|...          :.|:...|:.:..|..:...:||...:.....|..::    
  Fly    67 LTIYSLFVATFFALFYIWNIYNEISTGQINLRDTIGIYCYMNVCVCLFNYVTQWEKTLQII---- 127

  Fly   153 KLFFTLCGCFHEIIPLFENSHFDDISQMVGTGFGIY---------------------------MW 190
                    .|...:|||:.....|||.|:.....||                           .|
  Fly   128 --------RFQNSVPLFKVLDSLDISAMIVWRAFIYGLLKIVFCPLITYITLILYHRRSISESQW 184

  Fly   191 LGTLCV-----------LDACFLGFLV-SGILYEHMANNIIAMLKRMEPIESQDERYRMTKYRRM 243
            ......           ::.||.|.|| :.:::..:...:..::|....::|..:......|.||
  Fly   185 TSVTTTKTMLPLIVSNQINNCFFGGLVLANLIFAAVNRKLHGIVKEANMLQSPVQMNLHKPYYRM 249

  Fly   244 QLLCDFADELDECAAIYSELYHVTNSFRRILQWQILFYIYLNFINICLMLY-QYIL---HFLNDD 304
            :..|:.||.|||.|..|......:.::.|...|.::..:.:|.:.|.:..| ||:.   |::|::
  Fly   250 RRFCELADLLDELARKYGFTASRSKNYLRFTDWSMVLSMLMNLLGITMGCYNQYLAIADHYINEE 314

  Fly   305 EV-VFVSIVMAF---VKLANLVLLMMCADYTV----RQSEVPKKLPLDIVCSDMDERWDKSVETF 361
            .. :|::||:..   |....||::...::.|:    |..|:.::..|    ...|.|:.:.|..|
  Fly   315 PFDLFLAIVLVVFLAVPFLELVMVARISNQTLVETRRTGELLQRFDL----QHADARFKQVVNAF 375

  Fly   362 LGQLQTQRLEIKVLGFFHLNNEFILLILSAIISYLFILIQFGIT 405
            ..|:.|...::..||...||...:..:.|:.|..|.||||..:|
  Fly   376 WLQVVTINYKLMPLGLLELNTSLVNKVFSSAIGSLLILIQSDLT 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr93aNP_524442.2 7tm_7 46..405 CDD:303125 83/424 (20%)
Gr97aNP_001287551.1 7tm_7 54..419 CDD:285581 74/380 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.