DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CASK and CPK19

DIOPT Version :9

Sequence 1:NP_001262811.1 Gene:CASK / 42567 FlyBaseID:FBgn0013759 Length:929 Species:Drosophila melanogaster
Sequence 2:NP_176386.2 Gene:CPK19 / 842490 AraportID:AT1G61950 Length:551 Species:Arabidopsis thaliana


Alignment Length:484 Identity:137/484 - (28%)
Similarity:226/484 - (46%) Gaps:70/484 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FDDV---YELCEVIGKGPFSIVRRCIHRESNQQFAVKIVDVAKFTASPGLSTADLKREATICHML 69
            |:|:   |.|...:|:|.|.|...|....|.:.||.|.:...|...:.  ...|::||..|.|.|
plant    91 FEDIKEKYSLGRELGRGQFGITYICTEISSGKNFACKSILKRKLIRTK--DREDVRREIQIMHYL 153

  Fly    70 K-HPHIVELLETYSSEGMLYMVFEFMEGSDLCFEVVRRAVAGFVYSEAVACHYMRQILEALRYCH 133
            . .|:|||:...|.....:::|.|..||.:|..::.:|.    .|||..|...:|.:::.::.||
plant   154 SGQPNIVEIKGAYEDRQSVHLVMELCEGGELFDKITKRG----HYSEKAAAEIIRSVVKVVQICH 214

  Fly   134 ENDILHRDVRPACALLATVDN-SAPVKLGGFGSAIQLPGTR--ETIETHGRVGCPHYMAPEVVTR 195
            ...::|||::|...||::.|. |:.:|...||.::.:...:  |.|     ||..:|:||||: :
plant   215 FMGVIHRDLKPENFLLSSKDEASSMLKATDFGVSVFIEEGKVYEDI-----VGSAYYVAPEVL-K 273

  Fly   196 RLYGKGCDVWGAGVMLHVLLSGRLPFLGSGVR-LQQSVARGRLSFEAPEWKSISANAKDLVMKML 259
            |.|||..|:|.|||:|::||.|..||.....: :.:.:.||.:.||:..|.|||.:|||||..||
plant   274 RNYGKAIDIWSAGVILYILLCGNPPFWAETDKGIFEEILRGEIDFESEPWPSISESAKDLVRNML 338

  Fly   260 AANPHHRLSITEVLDHPWIRD----RDKLQRTHLADTVEELKRYNARRK--------------LK 306
            ..:|..|.:..:||:|||||:    .||...:.:...:::|:..|..:|              ||
plant   339 KYDPKKRFTAAQVLEHPWIREGGEASDKPIDSAVLSRMKQLRAMNKLKKLAFKFIAQNLKEEELK 403

  Fly   307 GAVQAIAGGTNMDPLYATDADMPITGATDEWADEEAGIEAVQRILDCLDDIYSLQDAHVDADVLR 371
            |.....|   |||    ||....||     :.:.::|:|.:...|...:....|:||.||.:...
plant   404 GLKTMFA---NMD----TDKSGTIT-----YDELKSGLEKLGSRLTETEVKQLLEDADVDGNGTI 456

  Fly   372 DML-------------RDNRLHQFLQLFDRIAATVVTSNGRAPAAEAVGRCRDVL--EQLSSTSG 421
            |.:             |::.|.:..|.||:..:..::......|.:......|::  |.:|....
plant   457 DYIEFISATMNRFRVEREDNLFKAFQHFDKDNSGFISRQELETAMKEYNMGDDIMIKEIISEVDA 521

  Fly   422 GNSLGGKYAKEE---LMRLLAAPHMQALL 447
            .|.  |....:|   :|:..:..|...|:
plant   522 DND--GSINYQEFCNMMKSCSQSHQSKLV 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CASKNP_001262811.1 STKc_CASK 8..308 CDD:270996 104/325 (32%)
S_TKc 12..278 CDD:214567 92/270 (34%)
L27 347..396 CDD:280918 12/61 (20%)
L27 406..462 CDD:280918 9/47 (19%)
PDZ_signaling 493..573 CDD:238492
SH3_CASK 586..646 CDD:213014
Guanylate_kin 710..883 CDD:279019
GuKc 720..883 CDD:214504
CPK19NP_176386.2 STKc_CAMK 97..356 CDD:270687 91/270 (34%)
Pkinase 98..357 CDD:278497 92/270 (34%)
PTZ00184 393..538 CDD:185504 33/158 (21%)
EFh 405..464 CDD:238008 17/70 (24%)
EFh 477..537 CDD:238008 11/61 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.