DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CASK and CDPK2

DIOPT Version :9

Sequence 1:NP_001262811.1 Gene:CASK / 42567 FlyBaseID:FBgn0013759 Length:929 Species:Drosophila melanogaster
Sequence 2:NP_174807.1 Gene:CDPK2 / 840471 AraportID:AT1G35670 Length:495 Species:Arabidopsis thaliana


Alignment Length:451 Identity:131/451 - (29%)
Similarity:210/451 - (46%) Gaps:61/451 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DVYELCEVIGKGPFSIVRRCIHRESNQQFAVKIVDVAKFTASPGLSTADLKREATICHML-KHPH 73
            |.|.|.:.:|:|.|.....|..:.::..:|.|.:...|........  |:.||..|.|.| :||:
plant    24 DHYLLGKKLGQGQFGTTYLCTEKSTSANYACKSIPKRKLVCREDYE--DVWREIQIMHHLSEHPN 86

  Fly    74 IVELLETYSSEGMLYMVFEFMEGSDLCFEVVRRAVAGFVYSEAVACHYMRQILEALRYCHENDIL 138
            :|.:..||.....:::|.|..||.:|...:|.:.    .:||..|...::.||..:..||...::
plant    87 VVRIKGTYEDSVFVHIVMEVCEGGELFDRIVSKG----HFSEREAVKLIKTILGVVEACHSLGVM 147

  Fly   139 HRDVRPACALLATVDNSAPVKLGGFG-SAIQLPGTRETIETHGRVGCPHYMAPEVVTRRLYGKGC 202
            |||::|...|..:..:.|.:|...|| |....||.    ..:..||.|:|:||||: ::.||...
plant   148 HRDLKPENFLFDSPKDDAKLKATDFGLSVFYKPGQ----YLYDVVGSPYYVAPEVL-KKCYGPEI 207

  Fly   203 DVWGAGVMLHVLLSGRLPFLG---SGVRLQQSVARGRLSFEAPEWKSISANAKDLVMKMLAANPH 264
            |||.|||:|::||||..||..   ||:..|  :.:|:|.|::..|.:||..||||:.|||..:|.
plant   208 DVWSAGVILYILLSGVPPFWAETESGIFRQ--ILQGKLDFKSDPWPTISEAAKDLIYKMLERSPK 270

  Fly   265 HRLSITEVLDHPWIRDRDKLQRTHLADTV-EELKRYNARRKLKG-AVQAIA--------GG-TNM 318
            .|:|..|.|.||||.|........|...| ..||:::...|:|. |::.||        || ..:
plant   271 KRISAHEALCHPWIVDEQAAPDKPLDPAVLSRLKQFSQMNKIKKMALRVIAERLSEEEIGGLKEL 335

  Fly   319 DPLYATDADMPITGATDEWADEEAGIEAV-QRILDCLDDIYSLQDAHVDADV------------- 369
            ..:..||....||     :.:.:||::.| ..:::  .:|.||.||   ||:             
plant   336 FKMIDTDNSGTIT-----FEELKAGLKRVGSELME--SEIKSLMDA---ADIDNSGTIDYGEFLA 390

  Fly   370 ----LRDMLRDNRLHQFLQLFDRIAATVVTSNGRAPAAEAVGRC----RDVLEQLSSTSGG 422
                :..|.|:..|......||:..:..:|.:....|....|.|    .|:::::...:.|
plant   391 ATLHMNKMEREENLVAAFSYFDKDGSGYITIDELQSACTEFGLCDTPLDDMIKEIDLDNDG 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CASKNP_001262811.1 STKc_CASK 8..308 CDD:270996 101/304 (33%)
S_TKc 12..278 CDD:214567 91/270 (34%)
L27 347..396 CDD:280918 13/66 (20%)
L27 406..462 CDD:280918 4/21 (19%)
PDZ_signaling 493..573 CDD:238492
SH3_CASK 586..646 CDD:213014
Guanylate_kin 710..883 CDD:279019
GuKc 720..883 CDD:214504
CDPK2NP_174807.1 STKc_CAMK 25..283 CDD:270687 90/270 (33%)
Pkinase 26..284 CDD:278497 91/270 (34%)
PTZ00184 320..462 CDD:185504 29/142 (20%)
EFh 332..391 CDD:238008 14/68 (21%)
EFh 404..463 CDD:238008 9/48 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.