DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CASK and CDPK9

DIOPT Version :9

Sequence 1:NP_001262811.1 Gene:CASK / 42567 FlyBaseID:FBgn0013759 Length:929 Species:Drosophila melanogaster
Sequence 2:NP_197748.1 Gene:CDPK9 / 832424 AraportID:AT5G23580 Length:490 Species:Arabidopsis thaliana


Alignment Length:414 Identity:133/414 - (32%)
Similarity:204/414 - (49%) Gaps:43/414 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DDVYELCEVIGKGPFSIVRRCIHRESNQQFAVKIVDVAKFTASPGLSTADLKREATICHML-KHP 72
            :|.|.|.:|:|:|.|.....|.|:::.|:.|.|.:...|........  |:.||..|.|.| ::|
plant    19 EDNYFLGQVLGQGQFGTTFLCTHKQTGQKLACKSIPKRKLLCQEDYD--DVLREIQIMHHLSEYP 81

  Fly    73 HIVELLETYSSEGMLYMVFEFMEGSDLCFEVVRRAVAGFVYSEAVACHYMRQILEALRYCHENDI 137
            ::|.:...|.....:::|.|..||.:|...:|:|.    .|||..|...::.|:..:..||...:
plant    82 NVVRIESAYEDTKNVHLVMELCEGGELFDRIVKRG----HYSEREAAKLIKTIVGVVEACHSLGV 142

  Fly   138 LHRDVRPACALLATVDNSAPVKLGGFG-SAIQLPGTRETIETHGR-VGCPHYMAPEVVTRRLYGK 200
            :|||::|...|.::.|..|.:|...|| |....||     |.... ||..:|:||||:.:. ||.
plant   143 VHRDLKPENFLFSSSDEDASLKSTDFGLSVFCTPG-----EAFSELVGSAYYVAPEVLHKH-YGP 201

  Fly   201 GCDVWGAGVMLHVLLSGRLPFLG-SGVRLQQSVARGRLSFEAPEWKSISANAKDLVMKMLAANPH 264
            .||||.|||:|::||.|..||.. |.:.:.:.:.:|:|.||...|.|||.:||||:.|||.:||.
plant   202 ECDVWSAGVILYILLCGFPPFWAESEIGIFRKILQGKLEFEINPWPSISESAKDLIKKMLESNPK 266

  Fly   265 HRLSITEVLDHPWIRDRDKLQRTHLAD--TVEELKRYNARRKLKG-AVQAIA--------GGTNM 318
            .||:..:||.||||.| ||:......|  .|..||:::|..|||. |::.||        ||  :
plant   267 KRLTAHQVLCHPWIVD-DKVAPDKPLDCAVVSRLKKFSAMNKLKKMALRVIAERLSEEEIGG--L 328

  Fly   319 DPLY-ATDADMPITGATDEWADE---------EAGIEAVQRILDCLDDIYSLQDAHVDADV--LR 371
            ..|: ..|.|...|...:|..|.         |:.|:.:.|..| :|:..::......|..  |.
plant   329 KELFKMIDTDKSGTITFEELKDSMRRVGSELMESEIQELLRAAD-VDESGTIDYGEFLAATIHLN 392

  Fly   372 DMLRDNRLHQFLQLFDRIAATVVT 395
            .:.|:..|......||:.|:..:|
plant   393 KLEREENLVAAFSFFDKDASGYIT 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CASKNP_001262811.1 STKc_CASK 8..308 CDD:270996 109/305 (36%)
S_TKc 12..278 CDD:214567 95/269 (35%)
L27 347..396 CDD:280918 11/51 (22%)
L27 406..462 CDD:280918
PDZ_signaling 493..573 CDD:238492
SH3_CASK 586..646 CDD:213014
Guanylate_kin 710..883 CDD:279019
GuKc 720..883 CDD:214504
CDPK9NP_197748.1 STKc_CAMK 21..279 CDD:270687 94/269 (35%)
Pkinase 22..280 CDD:278497 95/269 (35%)
PTZ00184 316..458 CDD:185504 23/104 (22%)
EFh 328..387 CDD:238008 11/59 (19%)
EFh 400..459 CDD:238008 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.