DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CASK and CPK13

DIOPT Version :9

Sequence 1:NP_001262811.1 Gene:CASK / 42567 FlyBaseID:FBgn0013759 Length:929 Species:Drosophila melanogaster
Sequence 2:NP_190753.2 Gene:CPK13 / 824348 AraportID:AT3G51850 Length:528 Species:Arabidopsis thaliana


Alignment Length:409 Identity:120/409 - (29%)
Similarity:197/409 - (48%) Gaps:47/409 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DDVYELCEVIGKGPFSIVRRCIHRESNQQFAVKIVDVAKFTASPGLSTADLKREATIC-HMLKHP 72
            :|.|.|...:|:|.|.:...||.|.|....|.|.:...|...:  :...|:|||..|. |:.|..
plant    51 EDRYLLDRELGRGEFGVTYLCIERSSRDLLACKSISKRKLRTA--VDIEDVKREVAIMKHLPKSS 113

  Fly    73 HIVELLETYSSEGMLYMVFEFMEGSDLCFEVVRRAVAGFVYSEAVACHYMRQILEALRYCHENDI 137
            .||.|.|....:..:::|.|..||.:|...:|.|.    .|:|..|....:.|:|.::.||::.:
plant   114 SIVTLKEACEDDNAVHLVMELCEGGELFDRIVARG----HYTERAAAGVTKTIVEVVQLCHKHGV 174

  Fly   138 LHRDVRPACALLATVDNSAPVKLGGFGSAIQL-PGTRETIETHGRVGCPHYMAPEVVTRRLYGKG 201
            :|||::|...|.|....::|:|...||.:|.. ||.:.:    ..||.|:||||||: :|.||..
plant   175 IHRDLKPENFLFANKKENSPLKAIDFGLSIFFKPGEKFS----EIVGSPYYMAPEVL-KRNYGPE 234

  Fly   202 CDVWGAGVMLHVLLSGRLPFLGSGVR-LQQSVARGRLSFEAPEWKSISANAKDLVMKMLAANPHH 265
            .|:|.|||:|::||.|..||.....: :.|::.||.:.|:...|.:||..||:||.:||..:|..
plant   235 IDIWSAGVILYILLCGVPPFWAESEQGVAQAILRGVIDFKREPWPNISETAKNLVRQMLEPDPKR 299

  Fly   266 RLSITEVLDHPWIRDRDKLQRTHLADTVE-ELKRYNARRKLK-GAVQAIAGGTNMDPLYATDADM 328
            ||:..:||:||||::..|.....|.|.|: .||:::...:.| .|::.||      ...:|:...
plant   300 RLTAKQVLEHPWIQNAKKAPNVPLGDVVKSRLKQFSVMNRFKRKALRVIA------EFLSTEEVE 358

  Fly   329 PITGATDEWADEEAGIEAVQRILDCLDDIYSLQDAHVDADV------------------------ 369
            .|....::...:..||.:::.:...|.| :|.|.|..:..:                        
plant   359 DIKVMFNKMDTDNDGIVSIEELKAGLRD-FSTQLAESEVQMLIEAVDTKGKGTLDYGEFVAVSLH 422

  Fly   370 LRDMLRDNRLHQFLQLFDR 388
            |:.:..|..|.:....||:
plant   423 LQKVANDEHLRKAFSYFDK 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CASKNP_001262811.1 STKc_CASK 8..308 CDD:270996 103/303 (34%)
S_TKc 12..278 CDD:214567 93/268 (35%)
L27 347..396 CDD:280918 10/66 (15%)
L27 406..462 CDD:280918
PDZ_signaling 493..573 CDD:238492
SH3_CASK 586..646 CDD:213014
Guanylate_kin 710..883 CDD:279019
GuKc 720..883 CDD:214504
CPK13NP_190753.2 STKc_CAMK 53..311 CDD:270687 92/268 (34%)
FRQ1 352..493 CDD:227455 14/91 (15%)
EFh_PEF 470..>526 CDD:355382
EF-hand motif 470..497 CDD:320054
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.