DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CASK and CAMK2D

DIOPT Version :9

Sequence 1:NP_001262811.1 Gene:CASK / 42567 FlyBaseID:FBgn0013759 Length:929 Species:Drosophila melanogaster
Sequence 2:NP_001308498.1 Gene:CAMK2D / 817 HGNCID:1462 Length:533 Species:Homo sapiens


Alignment Length:614 Identity:192/614 - (31%)
Similarity:277/614 - (45%) Gaps:146/614 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FDDVYELCEVIGKGPFSIVRRCIHRESNQQFAVKIVDVAKFTASPGLSTAD---LKREATICHML 69
            |.|.|:|.|.:|||.||:||||:...:.|::|.||::..|      ||..|   |:|||.||.:|
Human    10 FTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKK------LSARDHQKLEREARICRLL 68

  Fly    70 KHPHIVELLETYSSEGMLYMVFEFMEGSDLCFEVVRRAVAGFVYSEAVACHYMRQILEALRYCHE 134
            |||:||.|.::.|.||..|:||:.:.|.:|..::|.|.    .||||.|.|.::||||::.:||.
Human    69 KHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVARE----YYSEADASHCIQQILESVNHCHL 129

  Fly   135 NDILHRDVRPACALLATVDNSAPVKLGGFGSAIQLPGTRETIETHGRVGCPHYMAPEVVTRRLYG 199
            |.|:|||::|...|||:....|.|||..||.||::.|.::.  ..|..|.|.|::|||:.:..||
Human   130 NGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQA--WFGFAGTPGYLSPEVLRKDPYG 192

  Fly   200 KGCDVWGAGVMLHVLLSGRLPFLGSGV-RLQQSVARGRLSFEAPEWKSISANAKDLVMKMLAANP 263
            |..|:|..||:|::||.|..||..... ||.|.:..|...|.:|||.:::..||||:.|||..||
Human   193 KPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINP 257

  Fly   264 HHRLSITEVLDHPWIRDRDKL-QRTHLADTVEELKRYNARRKLKGAVQAIAGGTNMDPLYATDAD 327
            ..|::.:|.|.||||..|..: ...|..:||:.||::|||||||||:        :..:.||   
Human   258 AKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKLKGAI--------LTTMLAT--- 311

  Fly   328 MPITGATDEWADEEAGIEAVQRILDCLDDIYSLQDAHVDADVLRDMLRDNRLHQFLQLFDRIAAT 392
                          ....|.:.:|...|.:..                :|:            |.
Human   312 --------------RNFSAAKSLLKKPDGVKI----------------NNK------------AN 334

  Fly   393 VVTS---NGRAPAAEAVGRCRDVLEQLSSTSGGNSLGGKYAKEELMRLLAAPHMQALLHSHDVVA 454
            ||||   |...||.|.           .:|...|..|.|.:.|.         ....:...||.|
Human   335 VVTSPKENIPTPALEP-----------QTTVIHNPDGNKESTES---------SNTTIEDEDVKA 379

  Fly   455 RDVYGEEALRVTPPPMVPYLNGD------------------ELDN-VEGGELQHVTRVRLVQFQK 500
            |.   :|.::||...:....|||                  .|.| |||.:..   |........
Human   380 RK---QEIIKVTEQLIEAINNGDFEAYTKICDPGLTAFEPEALGNLVEGMDFH---RFYFENALS 438

  Fly   501 NTDEPMGITL------KMTEDGRCI----VARIMHG-GMIHRQATLHVGDEIREINGQPVQHQSV 554
            .:::|:...:      .:.:|..||    :.:.|.| ||   ..|:. .:|.|      |.|:..
Human   439 KSNKPIHTIILNPHVHLVGDDAACIAYIRLTQYMDGSGM---PKTMQ-SEETR------VWHRRD 493

  Fly   555 GQLQRMLREARGSVTFKIVPSYRSAPPPC 583
            |:.|.:.....||.|..|       .|||
Human   494 GKWQNVHFHRSGSPTVPI-------KPPC 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CASKNP_001262811.1 STKc_CASK 8..308 CDD:270996 132/304 (43%)
S_TKc 12..278 CDD:214567 115/269 (43%)
L27 347..396 CDD:280918 6/48 (13%)
L27 406..462 CDD:280918 9/55 (16%)
PDZ_signaling 493..573 CDD:238492 18/90 (20%)
SH3_CASK 586..646 CDD:213014
Guanylate_kin 710..883 CDD:279019
GuKc 720..883 CDD:214504
CAMK2DNP_001308498.1 STKc_CaMKII 12..303 CDD:270988 131/302 (43%)
CaMKII_AD 380..507 CDD:285524 29/142 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0033
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.