DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CASK and Lrguk

DIOPT Version :9

Sequence 1:NP_001262811.1 Gene:CASK / 42567 FlyBaseID:FBgn0013759 Length:929 Species:Drosophila melanogaster
Sequence 2:XP_006506776.1 Gene:Lrguk / 74354 MGIID:1921604 Length:1341 Species:Mus musculus


Alignment Length:214 Identity:53/214 - (24%)
Similarity:88/214 - (41%) Gaps:42/214 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   714 LVLLGAHGVGRRHIKNTLISKYPDKYAYPIPHTTRPAKPEEENGRSYYFVSH---DEMMADIGAN 775
            |:|.|....|:|.:.:.|..::...:.|...|||||....|.:...|:|:|.   |||   :...
Mouse   417 LILTGPAACGKRELAHRLCRQFSTYFRYGACHTTRPPYFGEGDRVDYHFISQEVFDEM---LNMG 478

  Fly   776 EYL---EYGTHEDAMYGTKLDTIRRIHTEGKMAILDVEPQALKILRTAEFTPYVVFIAAPSLQNI 837
            :::   .||.|.   ||...|||..|..:|..:.:.:|.:.::.|:.:.|.|..:.:.....:. 
Mouse   479 KFILTFNYGNHN---YGLNRDTIEGIARDGLASCIHMELEGVRSLKYSYFEPRYILVVPMDKEK- 539

  Fly   838 ADYDGSLER--LAKESEM------------LRQLYGHFFDLTIVNND------------ISETIA 876
              |:|.|.|  |...:|:            :.|.|..:|| .::|.|            |.|.:.
Mouse   540 --YEGYLRRKGLFSRAEIEIAVSRVDLYVKVNQKYPGYFD-AVINADDMDIAYQKLSELIREYLG 601

  Fly   877 TLETAIDRVHTTPQWVPVS 895
            ..|||...:..|....|.|
Mouse   602 LTETAAKTLAPTAAGAPSS 620

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CASKNP_001262811.1 STKc_CASK 8..308 CDD:270996
S_TKc 12..278 CDD:214567
L27 347..396 CDD:280918
L27 406..462 CDD:280918
PDZ_signaling 493..573 CDD:238492
SH3_CASK 586..646 CDD:213014
Guanylate_kin 710..883 CDD:279019 50/200 (25%)
GuKc 720..883 CDD:214504 47/194 (24%)
LrgukXP_006506776.1 leucine-rich repeat 131..150 CDD:275380
internalin_A <132..>333 CDD:380193
leucine-rich repeat 151..172 CDD:275380
leucine-rich repeat 173..194 CDD:275380
leucine-rich repeat 195..216 CDD:275380
leucine-rich repeat 217..238 CDD:275380
leucine-rich repeat 258..281 CDD:275380
leucine-rich repeat 282..300 CDD:275380
leucine-rich repeat 304..328 CDD:275380
GMPK 416..537 CDD:238026 33/125 (26%)
PHA03247 <678..1233 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.