DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CASK and guk1b

DIOPT Version :9

Sequence 1:NP_001262811.1 Gene:CASK / 42567 FlyBaseID:FBgn0013759 Length:929 Species:Drosophila melanogaster
Sequence 2:NP_957018.1 Gene:guk1b / 393697 ZFINID:ZDB-GENE-020916-1 Length:223 Species:Danio rerio


Alignment Length:215 Identity:49/215 - (22%)
Similarity:94/215 - (43%) Gaps:52/215 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   712 KTLVLLGAHGVGRRHIKNTLISKYPDKYAYPIPHTTRPAKPEEENGR------------------ 758
            :.:||.|..|.|:..:...|:.:|...:.:.:.||||..:|.||:|:                  
Zfish     5 RPVVLSGPSGAGKSTLLKRLMKEYEGVFGFSVSHTTRNPRPGEEDGKGLNCLPMLLGATLLPVAD 69

  Fly   759 --------SYYFVSHDEMMADIGANEYLEYGTHEDAMYGTKLDTIRRIHTEGKMAILDVEPQALK 815
                    .|:||:.::|...|..:|::|.......||||...:|..:..:..:.||||:.|.::
Zfish    70 VLSSVTSEDYHFVTKEKMQEGIDKDEFIENAEFSGNMYGTSKSSIEDVQAQNLICILDVDIQGVR 134

  Fly   816 ILRTAEFTPYVVFIAAPSLQNI--------ADYDGSLER----------LAKESEMLRQLYGHFF 862
            .::..:..|..:.|..||::.:        .:.:.||::          |:||..:        |
Zfish   135 NIKKTDLNPIYISIQPPSMEILEKRLRDRQTETEDSLQKRLEAARIDMELSKEPGV--------F 191

  Fly   863 DLTIVNNDISETIATLETAI 882
            |:.|||:|:.|....|::.:
Zfish   192 DIVIVNDDLEEAYEKLKSVL 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CASKNP_001262811.1 STKc_CASK 8..308 CDD:270996
S_TKc 12..278 CDD:214567
L27 347..396 CDD:280918
L27 406..462 CDD:280918
PDZ_signaling 493..573 CDD:238492
SH3_CASK 586..646 CDD:213014
Guanylate_kin 710..883 CDD:279019 49/215 (23%)
GuKc 720..883 CDD:214504 46/207 (22%)
guk1bNP_957018.1 Gmk 1..219 CDD:223272 49/215 (23%)
guanyl_kin 5..213 CDD:213788 49/215 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.