DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CASK and GUK1

DIOPT Version :9

Sequence 1:NP_001262811.1 Gene:CASK / 42567 FlyBaseID:FBgn0013759 Length:929 Species:Drosophila melanogaster
Sequence 2:XP_005273161.1 Gene:GUK1 / 2987 HGNCID:4693 Length:263 Species:Homo sapiens


Alignment Length:181 Identity:47/181 - (25%)
Similarity:94/181 - (51%) Gaps:10/181 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   712 KTLVLLGAHGVGRRHIKNTLISKYPDKYAYPIPHTTRPAKPEEENGRSYYFVSHDEMMADIGANE 776
            :.:||.|..|.|:..:...|:.::...:.:.:.||||..:|.||||:.||||:.:.|..||.|.:
Human    71 RPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGD 135

  Fly   777 YLEYGTHEDAMYGTKLDTIRRIHTEGKMAILDVEPQALKILRTAEFTPYVVFIAAPSL------- 834
            ::|:......:|||....::.:....::.:|||:.|.::.::..:..|..:.:..|||       
Human   136 FIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRL 200

  Fly   835 --QNIADYDGSLERL-AKESEMLRQLYGHFFDLTIVNNDISETIATLETAI 882
              :|....:..::|| |.:::|........||:.|:|:.:.:..|.|:.|:
Human   201 RQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEAL 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CASKNP_001262811.1 STKc_CASK 8..308 CDD:270996
S_TKc 12..278 CDD:214567
L27 347..396 CDD:280918
L27 406..462 CDD:280918
PDZ_signaling 493..573 CDD:238492
SH3_CASK 586..646 CDD:213014
Guanylate_kin 710..883 CDD:279019 47/181 (26%)
GuKc 720..883 CDD:214504 44/173 (25%)
GUK1XP_005273161.1 Guanylate_kin 69..254 CDD:279019 47/181 (26%)
guanyl_kin 71..253 CDD:213788 47/181 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.