DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CASK and Camk2g

DIOPT Version :9

Sequence 1:NP_001262811.1 Gene:CASK / 42567 FlyBaseID:FBgn0013759 Length:929 Species:Drosophila melanogaster
Sequence 2:XP_006518551.1 Gene:Camk2g / 12325 MGIID:88259 Length:588 Species:Mus musculus


Alignment Length:307 Identity:129/307 - (42%)
Similarity:190/307 - (61%) Gaps:17/307 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FDDVYELCEVIGKGPFSIVRRCIHRESNQQFAVKIVDVAKFTASPGLSTAD---LKREATICHML 69
            |.|.|:|.|.:|||.||:||||:.:.|.|::|.||::..|      ||..|   |:|||.||.:|
Mouse    10 FTDDYQLFEELGKGAFSVVRRCVKKTSTQEYAAKIINTKK------LSARDHQKLEREARICRLL 68

  Fly    70 KHPHIVELLETYSSEGMLYMVFEFMEGSDLCFEVVRRAVAGFVYSEAVACHYMRQILEALRYCHE 134
            |||:||.|.::.|.||..|:||:.:.|.:|..::|.|.    .||||.|.|.:.||||::.:.|:
Mouse    69 KHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVARE----YYSEADASHCIHQILESVNHIHQ 129

  Fly   135 NDILHRDVRPACALLATVDNSAPVKLGGFGSAIQLPGTRETIETHGRVGCPHYMAPEVVTRRLYG 199
            :||:|||::|...|||:....|.|||..||.||::.|.::.  ..|..|.|.|::|||:.:..||
Mouse   130 HDIVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGEQQA--WFGFAGTPGYLSPEVLRKDPYG 192

  Fly   200 KGCDVWGAGVMLHVLLSGRLPFLGSGV-RLQQSVARGRLSFEAPEWKSISANAKDLVMKMLAANP 263
            |..|:|..||:|::||.|..||..... :|.|.:..|...|.:|||.:::..||:|:.:||..||
Mouse   193 KPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTINP 257

  Fly   264 HHRLSITEVLDHPWIRDRDKL-QRTHLADTVEELKRYNARRKLKGAV 309
            ..|::..:.|.|||:..|..: ...|..:|||.|:::|||||||||:
Mouse   258 AKRITADQALKHPWVCQRSTVASMMHRQETVECLRKFNARRKLKGAI 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CASKNP_001262811.1 STKc_CASK 8..308 CDD:270996 127/304 (42%)
S_TKc 12..278 CDD:214567 111/269 (41%)
L27 347..396 CDD:280918
L27 406..462 CDD:280918
PDZ_signaling 493..573 CDD:238492
SH3_CASK 586..646 CDD:213014
Guanylate_kin 710..883 CDD:279019
GuKc 720..883 CDD:214504
Camk2gXP_006518551.1 STKc_CaMKII 12..303 CDD:270988 126/302 (42%)
CaMKII_AD 456..583 CDD:285524
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0033
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.