DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CASK and mpp7b

DIOPT Version :9

Sequence 1:NP_001262811.1 Gene:CASK / 42567 FlyBaseID:FBgn0013759 Length:929 Species:Drosophila melanogaster
Sequence 2:XP_021324128.1 Gene:mpp7b / 101882129 ZFINID:ZDB-GENE-141212-293 Length:298 Species:Danio rerio


Alignment Length:256 Identity:102/256 - (39%)
Similarity:145/256 - (56%) Gaps:37/256 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   416 LSSTSGGNSLGGKYAKE-----------ELMRLLAAPHMQALLHSHDVVARDVYGEEALRVTPPP 469
            |.||.|   |..:.|:|           ||:.||:.||:|.||..|||||:..:..   |:.|.|
Zfish    26 LDSTQG---LAHRLAEELQDTVNSPETTELLNLLSKPHVQTLLLVHDVVAQKRFDP---RLPPLP 84

  Fly   470 MVPYLNGDELDNVEGGELQHVTRVRLVQFQKNTDEPMGITLKMTE-DGRCIVARIMHGGMIHRQA 533
            .:|..|.::.|:           :::|...|| .||:|.|:|..| .|..||||:|.||...|..
Zfish    85 PLPDCNEEDEDS-----------IKIVCLVKN-QEPLGATIKRDESSGAIIVARVMRGGAADRSG 137

  Fly   534 TLHVGDEIREINGQPVQHQSVGQLQRMLREARGSVTFKIVPSYRS--APPPCEIFVRAQFDYNPL 596
            .:|.||.::|:||.||:.:::.::..:|.::.|:||||:||....  .....::||||.|||:|.
Zfish   138 LIHEGDMLKEVNGVPVEDKNLQEIIPILAKSEGAVTFKVVPGTNEELETNDTQVFVRALFDYDPQ 202

  Fly   597 DDELIPCAQAGISFQVGDILQIISKDDHHWWQARLDTVGGS---AGLIPSPELQEWRIACQ 654
            .|..|||..||:.||.||:|||:|:||..|||||..  |.:   ||||||.:|||.|:..|
Zfish   203 ADPAIPCRDAGLEFQRGDVLQIVSQDDDTWWQARRH--GDANLRAGLIPSRQLQERRVMLQ 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CASKNP_001262811.1 STKc_CASK 8..308 CDD:270996
S_TKc 12..278 CDD:214567
L27 347..396 CDD:280918
L27 406..462 CDD:280918 21/56 (38%)
PDZ_signaling 493..573 CDD:238492 32/80 (40%)
SH3_CASK 586..646 CDD:213014 36/62 (58%)
Guanylate_kin 710..883 CDD:279019
GuKc 720..883 CDD:214504
mpp7bXP_021324128.1 L27 31..74 CDD:308467 18/45 (40%)
PDZ 97..179 CDD:214570 33/82 (40%)
SH3_MPP 192..252 CDD:212796 36/61 (59%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.