DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpI12 and DST1

DIOPT Version :9

Sequence 1:NP_524439.1 Gene:RpI12 / 42563 FlyBaseID:FBgn0038903 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_011472.1 Gene:DST1 / 852839 SGDID:S000003011 Length:309 Species:Saccharomyces cerevisiae


Alignment Length:106 Identity:33/106 - (31%)
Similarity:48/106 - (45%) Gaps:21/106 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VKGNVICYNCKKEFQPD----VYSGE-KSEFTIHFNTYD--PSKVFNRTK---RESESDADGPVV 77
            :..|||..|     .||    :.:|: ..||....:..|  |:.:..:.:   :::..:|.|..:
Yeast   202 IYSNVISKN-----NPDLKHKIANGDITPEFLATCDAKDLAPAPLKQKIEEIAKQNLYNAQGATI 261

  Fly    78 ERK------CPKCNHDKMSYATLQLRSADEGQTVFFTCLKC 112
            ||.      |.||...|:||..||.|||||..|.|.||..|
Yeast   262 ERSVTDRFTCGKCKEKKVSYYQLQTRSADEPLTTFCTCEAC 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpI12NP_524439.1 RPB9 10..119 CDD:224510 33/106 (31%)
Zn-ribbon_RPA12 73..119 CDD:259792 21/46 (46%)
DST1NP_011472.1 TFSII 3..309 CDD:273592 33/106 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.