DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Polr1H and RPB9

DIOPT Version :10

Sequence 1:NP_524439.1 Gene:Polr1H / 42563 FlyBaseID:FBgn0038903 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_011445.1 Gene:RPB9 / 852810 SGDID:S000003038 Length:122 Species:Saccharomyces cerevisiae


Alignment Length:110 Identity:29/110 - (26%)
Similarity:47/110 - (42%) Gaps:16/110 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FCPSCGSIL-PELQVKGNVICYNCK------KEFQPDVYSGEKSEFTIHFNTYDPSKVFNRTKRE 67
            ||..|.::| |....:.|.:.:.|:      :...|.||..|     :..|..:.:.|.    ::
Yeast     6 FCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHE-----LITNIGETAGVV----QD 61

  Fly    68 SESDADGPVVERKCPKCNHDKMSYATLQLRSADEGQTVFFTCLKC 112
            ..||...|..:|:||||:..:..:...|.|..|....:||.||.|
Yeast    62 IGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSC 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Polr1HNP_524439.1 RPB9 10..115 CDD:441202 29/110 (26%)
Zn-ribbon_RPA12 73..119 CDD:259792 14/40 (35%)
RPB9NP_011445.1 RPOL9 5..58 CDD:197822 12/56 (21%)
Zn-ribbon_RPB9 64..111 CDD:259793 16/43 (37%)

Return to query results.
Submit another query.