DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Polr1H and RPC11

DIOPT Version :10

Sequence 1:NP_524439.1 Gene:Polr1H / 42563 FlyBaseID:FBgn0038903 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_010330.1 Gene:RPC11 / 851615 SGDID:S000002452 Length:110 Species:Saccharomyces cerevisiae


Alignment Length:124 Identity:34/124 - (27%)
Similarity:50/124 - (40%) Gaps:31/124 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FCPSCGSILPELQVKGN-----VICYNCKKEFQPDVYSGEKSEFTIHFNTYDPSKVFNRTKRESE 69
            |||||.::|  |...|:     :.|.:|..||..:           ....||..|:    .|:..
Yeast     4 FCPSCNNML--LITSGDSGVYTLACRSCPYEFPIE-----------GIEIYDRKKL----PRKEV 51

  Fly    70 SDADG------PVVERKCPK---CNHDKMSYATLQLRSADEGQTVFFTCLKCKFKESEN 119
            .|..|      ...:.:||.   |..:...:..||:|||||..|.|:.|:.|..:..||
Yeast    52 DDVLGGGWDNVDQTKTQCPNYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCGHRWKEN 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Polr1HNP_524439.1 RPB9 10..115 CDD:441202 32/118 (27%)
Zn-ribbon_RPA12 73..119 CDD:259792 15/54 (28%)
RPC11NP_010330.1 RPB9 4..109 CDD:441202 32/121 (26%)
Zn-ribbon_RPC11 61..109 CDD:259794 14/47 (30%)

Return to query results.
Submit another query.