DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpI12 and AT3G25940

DIOPT Version :9

Sequence 1:NP_524439.1 Gene:RpI12 / 42563 FlyBaseID:FBgn0038903 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_566786.1 Gene:AT3G25940 / 822191 AraportID:AT3G25940 Length:119 Species:Arabidopsis thaliana


Alignment Length:109 Identity:31/109 - (28%)
Similarity:55/109 - (50%) Gaps:1/109 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FCPSCGSILPELQVKGNVICYNCKKEFQPDVYSGEKSEFTIHFNTYDPSKVFNRTKRESESDADG 74
            ||..||::| .|:......|.:||..........::..:|:...........:....:::::|:.
plant    11 FCNLCGTML-VLKSTKYAECPHCKTTRNAKDIIDKEIAYTVSAEDIRRELGISLFGEKTQAEAEL 74

  Fly    75 PVVERKCPKCNHDKMSYATLQLRSADEGQTVFFTCLKCKFKESE 118
            |.:::.|.||.|.::.|.|.|.||||||||.::||..|..:.:|
plant    75 PKIKKACEKCQHPELVYTTRQTRSADEGQTTYYTCPNCAHRFTE 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpI12NP_524439.1 RPB9 10..119 CDD:224510 31/109 (28%)
Zn-ribbon_RPA12 73..119 CDD:259792 20/46 (43%)
AT3G25940NP_566786.1 RPB9 9..118 CDD:224510 30/107 (28%)
Zn-ribbon_RPA12 75..118 CDD:259792 19/42 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1594
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 60 1.000 Inparanoid score I2548
OMA 1 1.010 - - QHG57307
OrthoDB 1 1.010 - - D1456544at2759
OrthoFinder 1 1.000 - - FOG0003996
OrthoInspector 1 1.000 - - oto4092
orthoMCL 1 0.900 - - OOG6_103317
Panther 1 1.100 - - LDO PTHR11239
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2760
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.840

Return to query results.
Submit another query.