DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpI12 and Med26

DIOPT Version :9

Sequence 1:NP_524439.1 Gene:RpI12 / 42563 FlyBaseID:FBgn0038903 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_081761.2 Gene:Med26 / 70625 MGIID:1917875 Length:588 Species:Mus musculus


Alignment Length:77 Identity:19/77 - (24%)
Similarity:35/77 - (45%) Gaps:15/77 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KKEFQPDVYS----GEKSEFTI-------HFNTYDP--SKVFNRTKRESESDADGPVVERKCPKC 84
            ||.::|..|:    |:.:|..:       ...|:||  .::...|::|... ||.||...:.|:.
Mouse   382 KKRYRPRDYTVNLDGQVAEAGVKPVRLKERKLTFDPMTRQIRPLTQKEPVR-ADSPVPTEQLPRT 445

  Fly    85 NHDKMSY-ATLQ 95
            ..::... |:||
Mouse   446 ELEQQEVKASLQ 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpI12NP_524439.1 RPB9 10..119 CDD:224510 19/77 (25%)
Zn-ribbon_RPA12 73..119 CDD:259792 7/24 (29%)
Med26NP_081761.2 TFS2N 12..86 CDD:197766
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 112..393 4/10 (40%)
Med26_M 178..405 CDD:292322 6/22 (27%)
Med26_C 407..586 CDD:292321 13/52 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 412..441 9/29 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.