DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Polr1H and TCEA3

DIOPT Version :10

Sequence 1:NP_524439.1 Gene:Polr1H / 42563 FlyBaseID:FBgn0038903 Length:120 Species:Drosophila melanogaster
Sequence 2:XP_016857689.1 Gene:TCEA3 / 6920 HGNCID:11615 Length:487 Species:Homo sapiens


Alignment Length:41 Identity:15/41 - (36%)
Similarity:23/41 - (56%) Gaps:2/41 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 KCPKCNHDKMSYATLQLRSADEGQTVFFTCLKC--KFKESE 118
            :|.||.....:|..:|.|||||..|.|..|.:|  ::|:.:
Human   309 QCSKCKKKNCTYNQVQTRSADEPMTTFVLCNECGNRWKDEQ 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Polr1HNP_524439.1 RPB9 10..115 CDD:441202 14/36 (39%)
Zn-ribbon_RPA12 73..119 CDD:259792 15/41 (37%)
TCEA3XP_016857689.1 TFSII 5..346 CDD:273592 14/36 (39%)

Return to query results.
Submit another query.