DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Polr1H and Polr3k

DIOPT Version :10

Sequence 1:NP_524439.1 Gene:Polr1H / 42563 FlyBaseID:FBgn0038903 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_080177.1 Gene:Polr3k / 67005 MGIID:1914255 Length:108 Species:Mus musculus


Alignment Length:112 Identity:34/112 - (30%)
Similarity:43/112 - (38%) Gaps:30/112 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FCPSCGS--ILPELQVKGNVICYNCKKEFQPDVYSGEKSEFTIHFNTYDPSKVFNR--TKRESES 70
            |||.||:  |:.|.|......|..|     |.|::..:             ||.||  .|.:...
Mouse     4 FCPGCGNGLIVEEGQRCHRFACNTC-----PYVHNITR-------------KVTNRKYPKLKEVD 50

  Fly    71 DADGPV--------VERKCPKCNHDKMSYATLQLRSADEGQTVFFTC 109
            |..|..        ....||||.|.:..:..||.|||||..|.|:.|
Mouse    51 DVLGGAAAWENVDSTAEPCPKCEHPRAYFMQLQTRSADEPMTTFYKC 97

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Polr1HNP_524439.1 RPB9 10..115 CDD:441202 34/112 (30%)
Zn-ribbon_RPA12 73..119 CDD:259792 16/45 (36%)
Polr3kNP_080177.1 RPB9 4..107 CDD:441202 34/112 (30%)
Zn-ribbon_RPC11 61..108 CDD:259794 15/37 (41%)