DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpI12 and Polr1h

DIOPT Version :9

Sequence 1:NP_524439.1 Gene:RpI12 / 42563 FlyBaseID:FBgn0038903 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_001342351.1 Gene:Polr1h / 66136 MGIID:1913386 Length:123 Species:Mus musculus


Alignment Length:117 Identity:50/117 - (42%)
Similarity:67/117 - (57%) Gaps:15/117 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FCPSCGSILPELQVKGNVICYNCKKEFQPDVYSGEKSEFTIHFNTYDPSKVFNR------TKRES 68
            |||.|||:||...::..|||..|  .|..||...|.       .....|.|||:      ...:.
Mouse    16 FCPDCGSVLPLPGIQDTVICSRC--GFSIDVRDCEG-------KVVKTSVVFNKLGATIPLSVDE 71

  Fly    69 ESDADGPVVERKCPKCNHDKMSYATLQLRSADEGQTVFFTCLKCKFKESENS 120
            ..:..|||::|:||:|.|:.|:|.|.|:||||||||||:||:.|||:|.|:|
Mouse    72 GPELQGPVIDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCINCKFQEKEDS 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpI12NP_524439.1 RPB9 10..119 CDD:224510 48/114 (42%)
Zn-ribbon_RPA12 73..119 CDD:259792 28/45 (62%)
Polr1hNP_001342351.1 OrfB_Zn_ribbon <17..46 CDD:332395 14/30 (47%)
Zn-ribbon_RPA12 76..122 CDD:259792 28/45 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850305
Domainoid 1 1.000 62 1.000 Domainoid score I10366
eggNOG 1 0.900 - - E1_COG1594
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40960
Inparanoid 1 1.050 97 1.000 Inparanoid score I5025
Isobase 1 0.950 - 0 Normalized mean entropy S1392
OMA 1 1.010 - - QHG57307
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003996
OrthoInspector 1 1.000 - - oto94408
orthoMCL 1 0.900 - - OOG6_103317
Panther 1 1.100 - - LDO PTHR11239
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2760
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.710

Return to query results.
Submit another query.