DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Polr1H and Polr1h

DIOPT Version :10

Sequence 1:NP_524439.1 Gene:Polr1H / 42563 FlyBaseID:FBgn0038903 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_075651.1 Gene:Polr1h / 66136 MGIID:1913386 Length:123 Species:Mus musculus


Alignment Length:117 Identity:50/117 - (42%)
Similarity:67/117 - (57%) Gaps:15/117 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FCPSCGSILPELQVKGNVICYNCKKEFQPDVYSGEKSEFTIHFNTYDPSKVFNR------TKRES 68
            |||.|||:||...::..|||..|  .|..||...|.       .....|.|||:      ...:.
Mouse    16 FCPDCGSVLPLPGIQDTVICSRC--GFSIDVRDCEG-------KVVKTSVVFNKLGATIPLSVDE 71

  Fly    69 ESDADGPVVERKCPKCNHDKMSYATLQLRSADEGQTVFFTCLKCKFKESENS 120
            ..:..|||::|:||:|.|:.|:|.|.|:||||||||||:||:.|||:|.|:|
Mouse    72 GPELQGPVIDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCINCKFQEKEDS 123

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Polr1HNP_524439.1 RPB9 10..115 CDD:441202 46/110 (42%)
Zn-ribbon_RPA12 73..119 CDD:259792 28/45 (62%)
Polr1hNP_075651.1 RPB9 16..115 CDD:441202 44/107 (41%)
Zn-ribbon_RPA12 76..122 CDD:259792 28/45 (62%)