DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpI12 and polr1h

DIOPT Version :9

Sequence 1:NP_524439.1 Gene:RpI12 / 42563 FlyBaseID:FBgn0038903 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_001013572.1 Gene:polr1h / 541428 ZFINID:ZDB-GENE-050320-131 Length:118 Species:Danio rerio


Alignment Length:120 Identity:48/120 - (40%)
Similarity:69/120 - (57%) Gaps:2/120 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDIFSNCPGFCPSCGSILPELQVKGNVICYNCKKEFQPDVYSGEKSEFTIHFNTYDPSKVFNRTK 65
            |..|.....|||.||:|||.......:.|..|..:.....::.:..:.::.||..|.|.|...:.
Zfish     1 MSCFRGDVDFCPECGNILPLPSRLNTITCPRCSFKISVQDFTSQVIKSSVMFNPLDQSNVAVGSA 65

  Fly    66 RESESDADGPVVERKCPKCNHDKMSYATLQLRSADEGQTVFFTCLKCKFKESENS 120
            .::|  ..|||::|||.:||.:.|.|.|.|:|||||||||||||:.|:|:|.|:|
Zfish    66 EDAE--LKGPVIDRKCSRCNKEGMVYHTRQMRSADEGQTVFFTCIHCRFQEKEDS 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpI12NP_524439.1 RPB9 10..119 CDD:224510 44/108 (41%)
Zn-ribbon_RPA12 73..119 CDD:259792 28/45 (62%)
polr1hNP_001013572.1 RPB9 10..117 CDD:224510 44/108 (41%)
Zn-ribbon_RPA12 71..117 CDD:259792 28/45 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596217
Domainoid 1 1.000 57 1.000 Domainoid score I10900
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40960
Inparanoid 1 1.050 100 1.000 Inparanoid score I4995
OMA 1 1.010 - - QHG57307
OrthoDB 1 1.010 - - D1456544at2759
OrthoFinder 1 1.000 - - FOG0003996
OrthoInspector 1 1.000 - - oto40205
orthoMCL 1 0.900 - - OOG6_103317
Panther 1 1.100 - - LDO PTHR11239
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1171
SonicParanoid 1 1.000 - - X2760
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.900

Return to query results.
Submit another query.