DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Polr1H and polr2i

DIOPT Version :10

Sequence 1:NP_524439.1 Gene:Polr1H / 42563 FlyBaseID:FBgn0038903 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_001006013.2 Gene:polr2i / 449992 ZFINID:ZDB-GENE-041010-106 Length:126 Species:Danio rerio


Alignment Length:118 Identity:28/118 - (23%)
Similarity:44/118 - (37%) Gaps:28/118 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PG-----FCPSCGSILPELQVKGNVI----CYNCKKEFQPDVYSGEKSEFTIHFNTYDPSKVFNR 63
            ||     ||..|.::|...:.|.|.|    |.||.       |..|.....|:.|     |:.:.
Zfish    10 PGFVGIRFCQECNNMLYPKEDKENRILLYACRNCD-------YQQEADNSCIYVN-----KITHE 62

  Fly    64 TKRESESDAD---GPVVER----KCPKCNHDKMSYATLQLRSADEGQTVFFTC 109
            ....::..||   .|.:.|    .||||.|.:..:.......|::...:::.|
Zfish    63 VDELTQIIADVAQDPTLPRTEDHPCPKCGHKEAVFFQSHSMKAEDAMRLYYVC 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Polr1HNP_524439.1 RPB9 10..115 CDD:441202 26/111 (23%)
Zn-ribbon_RPA12 73..119 CDD:259792 10/44 (23%)
polr2iNP_001006013.2 RPOL9 16..69 CDD:197822 15/64 (23%)
Zn-ribbon_RPB9 75..125 CDD:259793 9/41 (22%)

Return to query results.
Submit another query.