DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpI12 and RpII15

DIOPT Version :9

Sequence 1:NP_524439.1 Gene:RpI12 / 42563 FlyBaseID:FBgn0038903 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_001247099.1 Gene:RpII15 / 41741 FlyBaseID:FBgn0004855 Length:129 Species:Drosophila melanogaster


Alignment Length:129 Identity:34/129 - (26%)
Similarity:52/129 - (40%) Gaps:30/129 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PG-----FCPSCGSILPELQVKGNVI----CYNCKKEFQPD---VYSG----EKSEFTIHFNTYD 56
            ||     ||..|.::|...:.|.|.|    |.||..:.:.|   :|..    |..|.| |.   .
  Fly    13 PGFVGIRFCQECNNMLYPKEDKENKILLYACRNCDYKQEADSNCIYVNKIMHEIDELT-HI---V 73

  Fly    57 PSKVFNRTKRESESDADGPVVERKCPKCNHDKMSYATLQLRSADEGQTVFFTCL--KCKFKESE 118
            |..:.:.|...:|..|        ||||:|.:..:...|.|.|:|...:::.|.  .|..:.:|
  Fly    74 PDVISDPTLPRTEDHA--------CPKCSHREAVFFQAQTRRAEEEMRLYYVCTNQNCTHRWTE 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpI12NP_524439.1 RPB9 10..119 CDD:224510 32/122 (26%)
Zn-ribbon_RPA12 73..119 CDD:259792 12/48 (25%)
RpII15NP_001247099.1 RPB9 18..129 CDD:224510 31/122 (25%)
Zn-ribbon_RPB9 78..128 CDD:259793 14/57 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442317
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1594
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11239
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.